Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DinJ |
Location | 4182723..4183239 | Replicon | chromosome |
Accession | NZ_CP121076 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.3740 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A623NIH5 |
Locus tag | P8I06_RS20450 | Protein ID | WP_023993574.1 |
Coordinates | 4182723..4183007 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A633LVJ8 |
Locus tag | P8I06_RS20455 | Protein ID | WP_023993575.1 |
Coordinates | 4182997..4183239 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8I06_RS20435 (4177839) | 4177839..4179491 | + | 1653 | WP_023993572.1 | alpha,alpha-phosphotrehalase | - |
P8I06_RS20440 (4179900) | 4179900..4182038 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
P8I06_RS20445 (4182255) | 4182255..4182719 | + | 465 | WP_023993573.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
P8I06_RS20450 (4182723) | 4182723..4183007 | - | 285 | WP_023993574.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P8I06_RS20455 (4182997) | 4182997..4183239 | - | 243 | WP_023993575.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
P8I06_RS20460 (4183317) | 4183317..4185230 | - | 1914 | WP_023993576.1 | BglG family transcription antiterminator | - |
P8I06_RS20465 (4185247) | 4185247..4185987 | - | 741 | WP_023993577.1 | KDGP aldolase family protein | - |
P8I06_RS20470 (4185984) | 4185984..4187102 | - | 1119 | WP_023993578.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
P8I06_RS20475 (4187086) | 4187086..4188219 | - | 1134 | WP_023993579.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10925.70 Da Isoelectric Point: 9.8739
>T275646 WP_023993574.1 NZ_CP121076:c4183007-4182723 [Salmonella enterica subsp. enterica serovar Infantis]
MNYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MNYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A623NIH5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A633LVJ8 |