Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3516220..3516840 | Replicon | chromosome |
Accession | NZ_CP121076 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.3740 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | P8I06_RS17350 | Protein ID | WP_001280991.1 |
Coordinates | 3516622..3516840 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | P8I06_RS17345 | Protein ID | WP_000344807.1 |
Coordinates | 3516220..3516594 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8I06_RS17335 (3511359) | 3511359..3512552 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P8I06_RS17340 (3512575) | 3512575..3515724 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
P8I06_RS17345 (3516220) | 3516220..3516594 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
P8I06_RS17350 (3516622) | 3516622..3516840 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
P8I06_RS17355 (3517019) | 3517019..3517570 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
P8I06_RS17360 (3517688) | 3517688..3518158 | + | 471 | WP_000136183.1 | YlaC family protein | - |
P8I06_RS17365 (3518214) | 3518214..3518354 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
P8I06_RS17370 (3518360) | 3518360..3518620 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
P8I06_RS17375 (3518845) | 3518845..3520395 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
P8I06_RS17385 (3520626) | 3520626..3521015 | + | 390 | WP_000961285.1 | MGMT family protein | - |
P8I06_RS17390 (3521048) | 3521048..3521617 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T275643 WP_001280991.1 NZ_CP121076:3516622-3516840 [Salmonella enterica subsp. enterica serovar Infantis]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT275643 WP_000344807.1 NZ_CP121076:3516220-3516594 [Salmonella enterica subsp. enterica serovar Infantis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|