Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2298026..2298548 | Replicon | chromosome |
Accession | NZ_CP121076 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.3740 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | P8I06_RS11220 | Protein ID | WP_000221343.1 |
Coordinates | 2298026..2298310 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A5X3FYG4 |
Locus tag | P8I06_RS11225 | Protein ID | WP_000885426.1 |
Coordinates | 2298300..2298548 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8I06_RS11200 (2294105) | 2294105..2295613 | - | 1509 | WP_023993260.1 | FAD-dependent oxidoreductase | - |
P8I06_RS11205 (2295658) | 2295658..2296146 | + | 489 | WP_001293634.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
P8I06_RS11210 (2296339) | 2296339..2297418 | + | 1080 | WP_023993261.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
P8I06_RS11215 (2297466) | 2297466..2297855 | - | 390 | WP_023993262.1 | RidA family protein | - |
P8I06_RS11220 (2298026) | 2298026..2298310 | - | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P8I06_RS11225 (2298300) | 2298300..2298548 | - | 249 | WP_000885426.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P8I06_RS11230 (2298700) | 2298700..2298915 | + | 216 | WP_023993263.1 | phage protein | - |
P8I06_RS11235 (2298905) | 2298905..2299237 | + | 333 | WP_000253154.1 | DUF1493 family protein | - |
P8I06_RS11240 (2299517) | 2299517..2299711 | + | 195 | Protein_2202 | hypothetical protein | - |
P8I06_RS11245 (2299710) | 2299710..2300156 | - | 447 | Protein_2203 | helix-turn-helix domain-containing protein | - |
P8I06_RS11250 (2301062) | 2301062..2301970 | + | 909 | WP_242211998.1 | LysR family transcriptional regulator | - |
P8I06_RS11255 (2302144) | 2302144..2303124 | + | 981 | WP_023993266.1 | nitronate monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2292668..2304853 | 12185 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T275638 WP_000221343.1 NZ_CP121076:c2298310-2298026 [Salmonella enterica subsp. enterica serovar Infantis]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5X3FYG4 |