Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 316890..317476 Replicon chromosome
Accession NZ_CP121076
Organism Salmonella enterica subsp. enterica serovar Infantis strain R22.3740

Toxin (Protein)


Gene name doc Uniprot ID A0A5Y4K907
Locus tag P8I06_RS01465 Protein ID WP_023202025.1
Coordinates 317108..317476 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag P8I06_RS01460 Protein ID WP_023993856.1
Coordinates 316890..317111 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8I06_RS01435 (311911) 311911..313020 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
P8I06_RS01440 (313080) 313080..314006 + 927 WP_023183687.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
P8I06_RS01445 (314003) 314003..315280 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
P8I06_RS01450 (315277) 315277..316044 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P8I06_RS01455 (316046) 316046..316759 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P8I06_RS01460 (316890) 316890..317111 + 222 WP_023993856.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P8I06_RS01465 (317108) 317108..317476 + 369 WP_023202025.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P8I06_RS01470 (317735) 317735..319051 + 1317 WP_023993857.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P8I06_RS01475 (319156) 319156..320043 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P8I06_RS01480 (320040) 320040..320885 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P8I06_RS01485 (320887) 320887..321957 + 1071 WP_000907846.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 314003..322694 8691


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13703.01 Da        Isoelectric Point: 6.7252

>T275633 WP_023202025.1 NZ_CP121076:317108-317476 [Salmonella enterica subsp. enterica serovar Infantis]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRWHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0637

>AT275633 WP_023993856.1 NZ_CP121076:316890-317111 [Salmonella enterica subsp. enterica serovar Infantis]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRDLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Y4K907

Antitoxin

Source ID Structure

References