Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3677072..3677692 | Replicon | chromosome |
Accession | NZ_CP121075 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.2574 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | P8I05_RS17960 | Protein ID | WP_001280991.1 |
Coordinates | 3677474..3677692 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | P8I05_RS17955 | Protein ID | WP_000344807.1 |
Coordinates | 3677072..3677446 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8I05_RS17945 (3672211) | 3672211..3673404 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P8I05_RS17950 (3673427) | 3673427..3676576 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
P8I05_RS17955 (3677072) | 3677072..3677446 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
P8I05_RS17960 (3677474) | 3677474..3677692 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
P8I05_RS17965 (3677871) | 3677871..3678422 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
P8I05_RS17970 (3678540) | 3678540..3679010 | + | 471 | WP_000136183.1 | YlaC family protein | - |
P8I05_RS17975 (3679066) | 3679066..3679206 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
P8I05_RS17980 (3679212) | 3679212..3679472 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
P8I05_RS17985 (3679697) | 3679697..3681247 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
P8I05_RS17995 (3681478) | 3681478..3681867 | + | 390 | WP_000961285.1 | MGMT family protein | - |
P8I05_RS18000 (3681900) | 3681900..3682469 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T275628 WP_001280991.1 NZ_CP121075:3677474-3677692 [Salmonella enterica subsp. enterica serovar Infantis]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT275628 WP_000344807.1 NZ_CP121075:3677072-3677446 [Salmonella enterica subsp. enterica serovar Infantis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|