Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 2641692..2642214 | Replicon | chromosome |
| Accession | NZ_CP121075 | ||
| Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.2574 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | B5F5Y5 |
| Locus tag | P8I05_RS12750 | Protein ID | WP_000221343.1 |
| Coordinates | 2641930..2642214 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | A0A5X3FYG4 |
| Locus tag | P8I05_RS12745 | Protein ID | WP_000885426.1 |
| Coordinates | 2641692..2641940 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8I05_RS12715 (2637116) | 2637116..2638096 | - | 981 | WP_023993266.1 | nitronate monooxygenase | - |
| P8I05_RS12720 (2638270) | 2638270..2639178 | - | 909 | WP_023994284.1 | LysR family transcriptional regulator | - |
| P8I05_RS12725 (2640084) | 2640084..2640530 | + | 447 | Protein_2472 | helix-turn-helix domain-containing protein | - |
| P8I05_RS12730 (2640529) | 2640529..2640723 | - | 195 | Protein_2473 | hypothetical protein | - |
| P8I05_RS12735 (2641003) | 2641003..2641335 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
| P8I05_RS12740 (2641325) | 2641325..2641540 | - | 216 | WP_023993263.1 | phage protein | - |
| P8I05_RS12745 (2641692) | 2641692..2641940 | + | 249 | WP_000885426.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| P8I05_RS12750 (2641930) | 2641930..2642214 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P8I05_RS12755 (2642385) | 2642385..2642774 | + | 390 | WP_023993262.1 | RidA family protein | - |
| P8I05_RS12760 (2642822) | 2642822..2643901 | - | 1080 | WP_023993261.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| P8I05_RS12765 (2644094) | 2644094..2644582 | - | 489 | WP_001293634.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| P8I05_RS12770 (2644627) | 2644627..2646135 | + | 1509 | WP_023993260.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2635387..2648992 | 13605 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T275627 WP_000221343.1 NZ_CP121075:2641930-2642214 [Salmonella enterica subsp. enterica serovar Infantis]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JSW4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5X3FYG4 |