Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 646005..646591 | Replicon | chromosome |
| Accession | NZ_CP121075 | ||
| Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.2574 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | A0A5Y4K907 |
| Locus tag | P8I05_RS03095 | Protein ID | WP_023202025.1 |
| Coordinates | 646223..646591 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | - |
| Locus tag | P8I05_RS03090 | Protein ID | WP_023993856.1 |
| Coordinates | 646005..646226 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8I05_RS03065 (641026) | 641026..642135 | + | 1110 | WP_000822976.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| P8I05_RS03070 (642195) | 642195..643121 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| P8I05_RS03075 (643118) | 643118..644395 | + | 1278 | WP_000803764.1 | branched chain amino acid ABC transporter permease LivM | - |
| P8I05_RS03080 (644392) | 644392..645159 | + | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| P8I05_RS03085 (645161) | 645161..645874 | + | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| P8I05_RS03090 (646005) | 646005..646226 | + | 222 | WP_023993856.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| P8I05_RS03095 (646223) | 646223..646591 | + | 369 | WP_023202025.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| P8I05_RS03100 (646850) | 646850..648166 | + | 1317 | WP_023993857.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| P8I05_RS03105 (648271) | 648271..649158 | + | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| P8I05_RS03110 (649155) | 649155..650000 | + | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| P8I05_RS03115 (650002) | 650002..651072 | + | 1071 | WP_000907846.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 643118..651809 | 8691 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13703.01 Da Isoelectric Point: 6.7252
>T275620 WP_023202025.1 NZ_CP121075:646223-646591 [Salmonella enterica subsp. enterica serovar Infantis]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRWHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRWHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|