Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 646005..646591 Replicon chromosome
Accession NZ_CP121075
Organism Salmonella enterica subsp. enterica serovar Infantis strain R22.2574

Toxin (Protein)


Gene name doc Uniprot ID A0A5Y4K907
Locus tag P8I05_RS03095 Protein ID WP_023202025.1
Coordinates 646223..646591 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag P8I05_RS03090 Protein ID WP_023993856.1
Coordinates 646005..646226 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8I05_RS03065 (641026) 641026..642135 + 1110 WP_000822976.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
P8I05_RS03070 (642195) 642195..643121 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
P8I05_RS03075 (643118) 643118..644395 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
P8I05_RS03080 (644392) 644392..645159 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P8I05_RS03085 (645161) 645161..645874 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P8I05_RS03090 (646005) 646005..646226 + 222 WP_023993856.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P8I05_RS03095 (646223) 646223..646591 + 369 WP_023202025.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P8I05_RS03100 (646850) 646850..648166 + 1317 WP_023993857.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P8I05_RS03105 (648271) 648271..649158 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P8I05_RS03110 (649155) 649155..650000 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P8I05_RS03115 (650002) 650002..651072 + 1071 WP_000907846.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 643118..651809 8691


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13703.01 Da        Isoelectric Point: 6.7252

>T275620 WP_023202025.1 NZ_CP121075:646223-646591 [Salmonella enterica subsp. enterica serovar Infantis]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRWHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0637

>AT275620 WP_023993856.1 NZ_CP121075:646005-646226 [Salmonella enterica subsp. enterica serovar Infantis]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRDLADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Y4K907

Antitoxin

Source ID Structure

References