Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DinJ |
Location | 4183125..4183641 | Replicon | chromosome |
Accession | NZ_CP121073 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.2169 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A623NIH5 |
Locus tag | P8I07_RS20455 | Protein ID | WP_023993574.1 |
Coordinates | 4183125..4183409 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A633LVJ8 |
Locus tag | P8I07_RS20460 | Protein ID | WP_023993575.1 |
Coordinates | 4183399..4183641 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8I07_RS20440 (4178241) | 4178241..4179893 | + | 1653 | WP_023993572.1 | alpha,alpha-phosphotrehalase | - |
P8I07_RS20445 (4180302) | 4180302..4182440 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
P8I07_RS20450 (4182657) | 4182657..4183121 | + | 465 | WP_023993573.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
P8I07_RS20455 (4183125) | 4183125..4183409 | - | 285 | WP_023993574.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P8I07_RS20460 (4183399) | 4183399..4183641 | - | 243 | WP_023993575.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
P8I07_RS20465 (4183719) | 4183719..4185632 | - | 1914 | WP_023993576.1 | BglG family transcription antiterminator | - |
P8I07_RS20470 (4185649) | 4185649..4186389 | - | 741 | WP_023993577.1 | KDGP aldolase family protein | - |
P8I07_RS20475 (4186386) | 4186386..4187504 | - | 1119 | WP_023993578.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
P8I07_RS20480 (4187488) | 4187488..4188621 | - | 1134 | WP_023993579.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10925.70 Da Isoelectric Point: 9.8739
>T275610 WP_023993574.1 NZ_CP121073:c4183409-4183125 [Salmonella enterica subsp. enterica serovar Infantis]
MNYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MNYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A623NIH5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A633LVJ8 |