Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3516622..3517242 | Replicon | chromosome |
| Accession | NZ_CP121073 | ||
| Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.2169 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | P8I07_RS17355 | Protein ID | WP_001280991.1 |
| Coordinates | 3517024..3517242 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | P8I07_RS17350 | Protein ID | WP_000344807.1 |
| Coordinates | 3516622..3516996 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8I07_RS17340 (3511761) | 3511761..3512954 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| P8I07_RS17345 (3512977) | 3512977..3516126 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| P8I07_RS17350 (3516622) | 3516622..3516996 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| P8I07_RS17355 (3517024) | 3517024..3517242 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| P8I07_RS17360 (3517421) | 3517421..3517972 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| P8I07_RS17365 (3518090) | 3518090..3518560 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| P8I07_RS17370 (3518616) | 3518616..3518756 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| P8I07_RS17375 (3518762) | 3518762..3519022 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| P8I07_RS17380 (3519247) | 3519247..3520797 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| P8I07_RS17390 (3521028) | 3521028..3521417 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| P8I07_RS17395 (3521450) | 3521450..3522019 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T275607 WP_001280991.1 NZ_CP121073:3517024-3517242 [Salmonella enterica subsp. enterica serovar Infantis]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT275607 WP_000344807.1 NZ_CP121073:3516622-3516996 [Salmonella enterica subsp. enterica serovar Infantis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|