Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2298431..2298953 | Replicon | chromosome |
Accession | NZ_CP121073 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.2169 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | P8I07_RS11225 | Protein ID | WP_000221343.1 |
Coordinates | 2298431..2298715 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A5X3FYG4 |
Locus tag | P8I07_RS11230 | Protein ID | WP_000885426.1 |
Coordinates | 2298705..2298953 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8I07_RS11205 (2294510) | 2294510..2296018 | - | 1509 | WP_023993260.1 | FAD-dependent oxidoreductase | - |
P8I07_RS11210 (2296063) | 2296063..2296551 | + | 489 | WP_001293634.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
P8I07_RS11215 (2296744) | 2296744..2297823 | + | 1080 | WP_023993261.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
P8I07_RS11220 (2297871) | 2297871..2298260 | - | 390 | WP_023993262.1 | RidA family protein | - |
P8I07_RS11225 (2298431) | 2298431..2298715 | - | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P8I07_RS11230 (2298705) | 2298705..2298953 | - | 249 | WP_000885426.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P8I07_RS11235 (2299105) | 2299105..2299320 | + | 216 | WP_023993263.1 | phage protein | - |
P8I07_RS11240 (2299310) | 2299310..2299642 | + | 333 | WP_000253154.1 | DUF1493 family protein | - |
P8I07_RS11245 (2299922) | 2299922..2300116 | + | 195 | Protein_2203 | hypothetical protein | - |
P8I07_RS11250 (2300115) | 2300115..2300561 | - | 447 | Protein_2204 | helix-turn-helix domain-containing protein | - |
P8I07_RS11255 (2301467) | 2301467..2302375 | + | 909 | WP_242211998.1 | LysR family transcriptional regulator | - |
P8I07_RS11260 (2302549) | 2302549..2303529 | + | 981 | WP_023993266.1 | nitronate monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2293073..2305258 | 12185 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T275602 WP_000221343.1 NZ_CP121073:c2298715-2298431 [Salmonella enterica subsp. enterica serovar Infantis]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5X3FYG4 |