Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 1564568..1565211 | Replicon | chromosome |
Accession | NZ_CP121073 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.2169 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | P8I07_RS07515 | Protein ID | WP_001044768.1 |
Coordinates | 1564568..1564984 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | P8I07_RS07520 | Protein ID | WP_001261287.1 |
Coordinates | 1564981..1565211 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8I07_RS07500 (1561067) | 1561067..1561657 | - | 591 | WP_000194575.1 | hypothetical protein | - |
P8I07_RS07505 (1561657) | 1561657..1561914 | - | 258 | WP_000343085.1 | hypothetical protein | - |
P8I07_RS07510 (1562268) | 1562268..1564406 | + | 2139 | WP_075322282.1 | AAA family ATPase | - |
P8I07_RS07515 (1564568) | 1564568..1564984 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P8I07_RS07520 (1564981) | 1564981..1565211 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
P8I07_RS07525 (1565519) | 1565519..1567084 | + | 1566 | WP_000741348.1 | AAA family ATPase | - |
P8I07_RS07530 (1567141) | 1567141..1568010 | - | 870 | WP_000253407.1 | hypothetical protein | - |
P8I07_RS07535 (1568012) | 1568012..1569100 | - | 1089 | WP_000952231.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | tet(A) | - | 1498169..1659348 | 161179 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T275600 WP_001044768.1 NZ_CP121073:c1564984-1564568 [Salmonella enterica subsp. enterica serovar Infantis]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |