275595

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 49897..50422 Replicon plasmid pR22.0044_195k
Accession NZ_CP121071
Organism Salmonella enterica subsp. enterica serovar Infantis strain R22.0044

Toxin (Protein)


Gene name ccdB Uniprot ID A0A5Y5FBU7
Locus tag P8I10_RS23960 Protein ID WP_023994134.1
Coordinates 50117..50422 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A5T8X4Y4
Locus tag P8I10_RS23955 Protein ID WP_023994135.1
Coordinates 49897..50115 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8I10_RS23920 (P8I10_23920) 44929..45693 + 765 WP_023994141.1 minor fimbrial protein -
P8I10_RS23925 (P8I10_23925) 45896..46486 + 591 WP_023994140.1 hypothetical protein -
P8I10_RS23930 (P8I10_23930) 46552..46764 + 213 WP_023994139.1 FaeA/PapI family transcriptional regulator -
P8I10_RS23935 (P8I10_23935) 47025..47186 + 162 WP_001816720.1 hypothetical protein -
P8I10_RS23940 (P8I10_23940) 47212..48060 + 849 WP_023994138.1 SdiA-regulated domain-containing protein -
P8I10_RS23945 (P8I10_23945) 48630..49046 - 417 WP_023994137.1 type II toxin-antitoxin system VapC family toxin -
P8I10_RS23950 (P8I10_23950) 49043..49273 - 231 WP_023994136.1 type II toxin-antitoxin system VapB family antitoxin -
P8I10_RS23955 (P8I10_23955) 49897..50115 + 219 WP_023994135.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
P8I10_RS23960 (P8I10_23960) 50117..50422 + 306 WP_023994134.1 type II toxin-antitoxin system toxin CcdB Toxin
P8I10_RS23965 (P8I10_23965) 50424..50714 + 291 WP_023994133.1 hypothetical protein -
P8I10_RS23970 (P8I10_23970) 50711..50986 + 276 Protein_59 3'-5' exonuclease -
P8I10_RS23975 (P8I10_23975) 51057..51173 + 117 Protein_60 hypothetical protein -
P8I10_RS23980 (P8I10_23980) 51163..51878 - 716 Protein_61 transposase -
P8I10_RS23985 (P8I10_23985) 53160..53696 + 537 WP_023994130.1 fimbrial protein -
P8I10_RS23990 (P8I10_23990) 53749..54480 + 732 WP_023994129.1 fimbria/pilus periplasmic chaperone -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid floR / aph(4)-Ia / aac(3)-IVa / dfrA14 / aph(3')-Ia faeC / faeD / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS 1..195305 195305


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11708.47 Da        Isoelectric Point: 6.4685

>T275595 WP_023994134.1 NZ_CP121071:50117-50422 [Salmonella enterica subsp. enterica serovar Infantis]
MQFKVYTYKRESRYRLFVDVQSDIVDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRLMTTDMASVPASFIGEEV
AELSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8261.18 Da        Isoelectric Point: 4.7405

>AT275595 WP_023994135.1 NZ_CP121071:49897-50115 [Salmonella enterica subsp. enterica serovar Infantis]
MKQRITVTIDSDSYQLLKSADVNISGLVNTAMQKEARRLRAERWQAENQEGMAEVARFIEANGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Y5FBU7

Antitoxin

Source ID Structure
AlphaFold DB A0A5T8X4Y4

References