Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacT-ataR/DUF1778(antitoxin) |
| Location | 28611..29368 | Replicon | plasmid pR22.0044_195k |
| Accession | NZ_CP121071 | ||
| Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.0044 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A241PXX4 |
| Locus tag | P8I10_RS23825 | Protein ID | WP_023994162.1 |
| Coordinates | 28886..29368 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A727Z1I8 |
| Locus tag | P8I10_RS23820 | Protein ID | WP_001195098.1 |
| Coordinates | 28611..28895 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8I10_RS23775 (P8I10_23775) | 24452..24598 | - | 147 | Protein_20 | IS66 family insertion sequence element accessory protein TnpB | - |
| P8I10_RS23780 (P8I10_23780) | 24585..24914 | - | 330 | WP_023994169.1 | hypothetical protein | - |
| P8I10_RS23785 (P8I10_23785) | 25038..25891 | + | 854 | Protein_22 | site-specific tyrosine recombinase XerC | - |
| P8I10_RS23790 (P8I10_23790) | 25860..26147 | + | 288 | WP_031619580.1 | damage-inducible protein J | - |
| P8I10_RS23795 (P8I10_23795) | 26144..26449 | + | 306 | WP_023994167.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| P8I10_RS23800 (P8I10_23800) | 27199..27462 | + | 264 | WP_023994165.1 | DUF977 family protein | - |
| P8I10_RS23805 (P8I10_23805) | 27488..27823 | + | 336 | WP_023994164.1 | hypothetical protein | - |
| P8I10_RS23810 (P8I10_23810) | 28045..28242 | - | 198 | Protein_27 | PIN domain-containing protein | - |
| P8I10_RS23815 (P8I10_23815) | 28366..28455 | + | 90 | WP_071790431.1 | helix-turn-helix domain-containing protein | - |
| P8I10_RS23820 (P8I10_23820) | 28611..28895 | + | 285 | WP_001195098.1 | DUF1778 domain-containing protein | Antitoxin |
| P8I10_RS23825 (P8I10_23825) | 28886..29368 | + | 483 | WP_023994162.1 | GNAT family N-acetyltransferase | Toxin |
| P8I10_RS23830 (P8I10_23830) | 29683..30109 | + | 427 | Protein_31 | transposase | - |
| P8I10_RS23835 (P8I10_23835) | 30426..30635 | + | 210 | WP_023994160.1 | hemolysin expression modulator Hha | - |
| P8I10_RS23840 (P8I10_23840) | 30709..31061 | - | 353 | Protein_33 | transposase | - |
| P8I10_RS23845 (P8I10_23845) | 31288..32261 | + | 974 | Protein_34 | IS256 family transposase | - |
| P8I10_RS23850 (P8I10_23850) | 32263..32505 | + | 243 | WP_023994156.1 | hypothetical protein | - |
| P8I10_RS23855 (P8I10_23855) | 32576..33532 | + | 957 | WP_023994155.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| P8I10_RS23860 (P8I10_23860) | 33591..33803 | + | 213 | WP_023994154.1 | hypothetical protein | - |
| P8I10_RS23865 (P8I10_23865) | 33845..34096 | - | 252 | WP_023994153.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | floR / aph(4)-Ia / aac(3)-IVa / dfrA14 / aph(3')-Ia | faeC / faeD / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS | 1..195305 | 195305 | |
| - | inside | IScluster/Tn | - | - | 23156..35660 | 12504 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17971.54 Da Isoelectric Point: 6.8521
>T275593 WP_023994162.1 NZ_CP121071:28886-29368 [Salmonella enterica subsp. enterica serovar Infantis]
MEISVTAPELLNEEHYLQQFDCGNDVLSDWLRRRAMKNQYLNASRTFVICPEGTKRVVGYYSIATGSVSHASLGRSLRQN
MPDPVPVVLLGRLAVDECTQGHSFGKWLLNDAVTRVSNLADQVGIKAIMVHAIDEQAKTFYEYFGFVQSPIAPNTLFYKI
MEISVTAPELLNEEHYLQQFDCGNDVLSDWLRRRAMKNQYLNASRTFVICPEGTKRVVGYYSIATGSVSHASLGRSLRQN
MPDPVPVVLLGRLAVDECTQGHSFGKWLLNDAVTRVSNLADQVGIKAIMVHAIDEQAKTFYEYFGFVQSPIAPNTLFYKI
Download Length: 483 bp
Antitoxin
Download Length: 95 a.a. Molecular weight: 10964.52 Da Isoelectric Point: 9.6539
>AT275593 WP_001195098.1 NZ_CP121071:28611-28895 [Salmonella enterica subsp. enterica serovar Infantis]
MQTTIRKSVRNKQINIRATDEERAVIDYAASLVSKNRTDFIIEKAVSEAQNIILDQRVFVLDDARYQAFIKQLEAPVQNT
EGRQRLMDVKPEWK
MQTTIRKSVRNKQINIRATDEERAVIDYAASLVSKNRTDFIIEKAVSEAQNIILDQRVFVLDDARYQAFIKQLEAPVQNT
EGRQRLMDVKPEWK
Download Length: 285 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A241PXX4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A727Z1I8 |