Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DinJ |
| Location | 4183368..4183884 | Replicon | chromosome |
| Accession | NZ_CP121070 | ||
| Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.0044 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A623NIH5 |
| Locus tag | P8I10_RS20445 | Protein ID | WP_023993574.1 |
| Coordinates | 4183368..4183652 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A633LVJ8 |
| Locus tag | P8I10_RS20450 | Protein ID | WP_023993575.1 |
| Coordinates | 4183642..4183884 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8I10_RS20430 (4178484) | 4178484..4180136 | + | 1653 | WP_023993572.1 | alpha,alpha-phosphotrehalase | - |
| P8I10_RS20435 (4180545) | 4180545..4182683 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| P8I10_RS20440 (4182900) | 4182900..4183364 | + | 465 | WP_023993573.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| P8I10_RS20445 (4183368) | 4183368..4183652 | - | 285 | WP_023993574.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P8I10_RS20450 (4183642) | 4183642..4183884 | - | 243 | WP_023993575.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| P8I10_RS20455 (4183962) | 4183962..4185875 | - | 1914 | WP_023993576.1 | BglG family transcription antiterminator | - |
| P8I10_RS20460 (4185892) | 4185892..4186632 | - | 741 | WP_023993577.1 | KDGP aldolase family protein | - |
| P8I10_RS20465 (4186629) | 4186629..4187747 | - | 1119 | WP_023993578.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| P8I10_RS20470 (4187731) | 4187731..4188864 | - | 1134 | WP_023993579.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10925.70 Da Isoelectric Point: 9.8739
>T275589 WP_023993574.1 NZ_CP121070:c4183652-4183368 [Salmonella enterica subsp. enterica serovar Infantis]
MNYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MNYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A623NIH5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A633LVJ8 |