Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3516865..3517485 | Replicon | chromosome |
| Accession | NZ_CP121070 | ||
| Organism | Salmonella enterica subsp. enterica serovar Infantis strain R22.0044 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | P8I10_RS17345 | Protein ID | WP_001280991.1 |
| Coordinates | 3517267..3517485 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | P8I10_RS17340 | Protein ID | WP_000344807.1 |
| Coordinates | 3516865..3517239 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8I10_RS17330 (3512004) | 3512004..3513197 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| P8I10_RS17335 (3513220) | 3513220..3516369 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| P8I10_RS17340 (3516865) | 3516865..3517239 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| P8I10_RS17345 (3517267) | 3517267..3517485 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| P8I10_RS17350 (3517664) | 3517664..3518215 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| P8I10_RS17355 (3518333) | 3518333..3518803 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| P8I10_RS17360 (3518859) | 3518859..3518999 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| P8I10_RS17365 (3519005) | 3519005..3519265 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| P8I10_RS17370 (3519490) | 3519490..3521040 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| P8I10_RS17380 (3521271) | 3521271..3521660 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| P8I10_RS17385 (3521693) | 3521693..3522262 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T275586 WP_001280991.1 NZ_CP121070:3517267-3517485 [Salmonella enterica subsp. enterica serovar Infantis]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT275586 WP_000344807.1 NZ_CP121070:3516865-3517239 [Salmonella enterica subsp. enterica serovar Infantis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|