Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 48630..49273 | Replicon | plasmid pR21.1575_195k |
| Accession | NZ_CP121069 | ||
| Organism | Salmonella enterica subsp. enterica serovar Infantis strain R21.1575 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A5T8FJ24 |
| Locus tag | P8I08_RS23985 | Protein ID | WP_023994137.1 |
| Coordinates | 48630..49046 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A5T3Q059 |
| Locus tag | P8I08_RS23990 | Protein ID | WP_023994136.1 |
| Coordinates | 49043..49273 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8I08_RS23955 (P8I08_23955) | 44110..44901 | + | 792 | WP_023994142.1 | F4 (K88) fimbria minor subunit FaeH | - |
| P8I08_RS23960 (P8I08_23960) | 44929..45693 | + | 765 | WP_023994141.1 | minor fimbrial protein | - |
| P8I08_RS23965 (P8I08_23965) | 45896..46486 | + | 591 | WP_023994140.1 | hypothetical protein | - |
| P8I08_RS23970 (P8I08_23970) | 46552..46764 | + | 213 | WP_023994139.1 | FaeA/PapI family transcriptional regulator | - |
| P8I08_RS23975 (P8I08_23975) | 47025..47186 | + | 162 | WP_001816720.1 | hypothetical protein | - |
| P8I08_RS23980 (P8I08_23980) | 47212..48060 | + | 849 | WP_023994138.1 | SdiA-regulated domain-containing protein | - |
| P8I08_RS23985 (P8I08_23985) | 48630..49046 | - | 417 | WP_023994137.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P8I08_RS23990 (P8I08_23990) | 49043..49273 | - | 231 | WP_023994136.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| P8I08_RS23995 (P8I08_23995) | 49897..50115 | + | 219 | WP_023994135.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| P8I08_RS24000 (P8I08_24000) | 50117..50422 | + | 306 | WP_023994134.1 | type II toxin-antitoxin system toxin CcdB | - |
| P8I08_RS24005 (P8I08_24005) | 50424..50714 | + | 291 | WP_023994133.1 | hypothetical protein | - |
| P8I08_RS24010 (P8I08_24010) | 50711..50986 | + | 276 | Protein_59 | 3'-5' exonuclease | - |
| P8I08_RS24015 (P8I08_24015) | 51057..51173 | + | 117 | Protein_60 | hypothetical protein | - |
| P8I08_RS24020 (P8I08_24020) | 51163..51878 | - | 716 | Protein_61 | transposase | - |
| P8I08_RS24025 (P8I08_24025) | 53160..53696 | + | 537 | WP_023994130.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | floR / aph(4)-Ia / aac(3)-IVa / dfrA14 / aph(3')-Ia | faeC / faeD / faeD / faeE / faeF / faeH / faeI / fyuA / ybtE / ybtT / ybtU / irp1 / irp2 / ybtA / ybtP / ybtQ / ybtX / ybtS | 1..195307 | 195307 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15123.58 Da Isoelectric Point: 8.5291
>T275573 WP_023994137.1 NZ_CP121069:c49046-48630 [Salmonella enterica subsp. enterica serovar Infantis]
VKKMYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVNATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWGR
VKKMYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHIELVDAFCARLDAILPWDRA
AVNATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWGR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5T8FJ24 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5T3Q059 |