Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-DinJ |
| Location | 4189596..4190112 | Replicon | chromosome |
| Accession | NZ_CP121068 | ||
| Organism | Salmonella enterica subsp. enterica serovar Infantis strain R21.1575 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A623NIH5 |
| Locus tag | P8I08_RS20485 | Protein ID | WP_023993574.1 |
| Coordinates | 4189596..4189880 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A633LVJ8 |
| Locus tag | P8I08_RS20490 | Protein ID | WP_023993575.1 |
| Coordinates | 4189870..4190112 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8I08_RS20470 (4184712) | 4184712..4186364 | + | 1653 | WP_023993572.1 | alpha,alpha-phosphotrehalase | - |
| P8I08_RS20475 (4186773) | 4186773..4188911 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| P8I08_RS20480 (4189128) | 4189128..4189592 | + | 465 | WP_023993573.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| P8I08_RS20485 (4189596) | 4189596..4189880 | - | 285 | WP_023993574.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P8I08_RS20490 (4189870) | 4189870..4190112 | - | 243 | WP_023993575.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| P8I08_RS20495 (4190190) | 4190190..4192103 | - | 1914 | WP_023993576.1 | BglG family transcription antiterminator | - |
| P8I08_RS20500 (4192120) | 4192120..4192860 | - | 741 | WP_023993577.1 | KDGP aldolase family protein | - |
| P8I08_RS20505 (4192857) | 4192857..4193975 | - | 1119 | WP_023993578.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| P8I08_RS20510 (4193959) | 4193959..4195092 | - | 1134 | WP_023993579.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10925.70 Da Isoelectric Point: 9.8739
>T275568 WP_023993574.1 NZ_CP121068:c4189880-4189596 [Salmonella enterica subsp. enterica serovar Infantis]
MNYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MNYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A623NIH5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A633LVJ8 |