Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3523093..3523713 | Replicon | chromosome |
Accession | NZ_CP121068 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain R21.1575 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | P8I08_RS17385 | Protein ID | WP_001280991.1 |
Coordinates | 3523495..3523713 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | P8I08_RS17380 | Protein ID | WP_000344807.1 |
Coordinates | 3523093..3523467 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8I08_RS17370 (3518232) | 3518232..3519425 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P8I08_RS17375 (3519448) | 3519448..3522597 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
P8I08_RS17380 (3523093) | 3523093..3523467 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
P8I08_RS17385 (3523495) | 3523495..3523713 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
P8I08_RS17390 (3523892) | 3523892..3524443 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
P8I08_RS17395 (3524561) | 3524561..3525031 | + | 471 | WP_000136183.1 | YlaC family protein | - |
P8I08_RS17400 (3525087) | 3525087..3525227 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
P8I08_RS17405 (3525233) | 3525233..3525493 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
P8I08_RS17410 (3525718) | 3525718..3527268 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
P8I08_RS17420 (3527499) | 3527499..3527888 | + | 390 | WP_000961285.1 | MGMT family protein | - |
P8I08_RS17425 (3527921) | 3527921..3528490 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T275565 WP_001280991.1 NZ_CP121068:3523495-3523713 [Salmonella enterica subsp. enterica serovar Infantis]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT275565 WP_000344807.1 NZ_CP121068:3523093-3523467 [Salmonella enterica subsp. enterica serovar Infantis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|