Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 2304902..2305424 | Replicon | chromosome |
| Accession | NZ_CP121068 | ||
| Organism | Salmonella enterica subsp. enterica serovar Infantis strain R21.1575 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | B5F5Y5 |
| Locus tag | P8I08_RS11255 | Protein ID | WP_000221343.1 |
| Coordinates | 2304902..2305186 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | A0A5X3FYG4 |
| Locus tag | P8I08_RS11260 | Protein ID | WP_000885426.1 |
| Coordinates | 2305176..2305424 (-) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8I08_RS11235 (2300981) | 2300981..2302489 | - | 1509 | WP_023993260.1 | FAD-dependent oxidoreductase | - |
| P8I08_RS11240 (2302534) | 2302534..2303022 | + | 489 | WP_001293634.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| P8I08_RS11245 (2303215) | 2303215..2304294 | + | 1080 | WP_023993261.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
| P8I08_RS11250 (2304342) | 2304342..2304731 | - | 390 | WP_023993262.1 | RidA family protein | - |
| P8I08_RS11255 (2304902) | 2304902..2305186 | - | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P8I08_RS11260 (2305176) | 2305176..2305424 | - | 249 | WP_000885426.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| P8I08_RS11265 (2305576) | 2305576..2305791 | + | 216 | WP_023993263.1 | phage protein | - |
| P8I08_RS11270 (2305781) | 2305781..2306113 | + | 333 | WP_000253154.1 | DUF1493 family protein | - |
| P8I08_RS11275 (2306393) | 2306393..2306587 | + | 195 | Protein_2209 | hypothetical protein | - |
| P8I08_RS11280 (2306586) | 2306586..2307032 | - | 447 | Protein_2210 | helix-turn-helix domain-containing protein | - |
| P8I08_RS11285 (2307938) | 2307938..2308846 | + | 909 | WP_242211998.1 | LysR family transcriptional regulator | - |
| P8I08_RS11290 (2309020) | 2309020..2310000 | + | 981 | WP_023993266.1 | nitronate monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2299544..2311729 | 12185 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T275560 WP_000221343.1 NZ_CP121068:c2305186-2304902 [Salmonella enterica subsp. enterica serovar Infantis]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JSW4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5X3FYG4 |