Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 1570505..1571148 | Replicon | chromosome |
Accession | NZ_CP121068 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain R21.1575 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | B1LRW4 |
Locus tag | P8I08_RS07545 | Protein ID | WP_001044768.1 |
Coordinates | 1570505..1570921 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D2WFK3 |
Locus tag | P8I08_RS07550 | Protein ID | WP_001261287.1 |
Coordinates | 1570918..1571148 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8I08_RS07530 (1567004) | 1567004..1567594 | - | 591 | WP_000194575.1 | hypothetical protein | - |
P8I08_RS07535 (1567594) | 1567594..1567851 | - | 258 | WP_000343085.1 | hypothetical protein | - |
P8I08_RS07540 (1568205) | 1568205..1570343 | + | 2139 | WP_075322282.1 | AAA family ATPase | - |
P8I08_RS07545 (1570505) | 1570505..1570921 | - | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P8I08_RS07550 (1570918) | 1570918..1571148 | - | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
P8I08_RS07555 (1571456) | 1571456..1573021 | + | 1566 | WP_000741348.1 | AAA family ATPase | - |
P8I08_RS07560 (1573078) | 1573078..1573947 | - | 870 | WP_000253407.1 | hypothetical protein | - |
P8I08_RS07565 (1573949) | 1573949..1575037 | - | 1089 | WP_000952231.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | blaCTX-M-65 | - | 1548059..1649630 | 101571 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T275558 WP_001044768.1 NZ_CP121068:c1570921-1570505 [Salmonella enterica subsp. enterica serovar Infantis]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A606Q844 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QFC4 |