Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3516104..3516724 | Replicon | chromosome |
Accession | NZ_CP121066 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain R21.0914 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | P8I09_RS17355 | Protein ID | WP_001280991.1 |
Coordinates | 3516506..3516724 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | P8I09_RS17350 | Protein ID | WP_000344807.1 |
Coordinates | 3516104..3516478 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8I09_RS17340 (3511243) | 3511243..3512436 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P8I09_RS17345 (3512459) | 3512459..3515608 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
P8I09_RS17350 (3516104) | 3516104..3516478 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
P8I09_RS17355 (3516506) | 3516506..3516724 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
P8I09_RS17360 (3516903) | 3516903..3517454 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
P8I09_RS17365 (3517572) | 3517572..3518042 | + | 471 | WP_000136183.1 | YlaC family protein | - |
P8I09_RS17370 (3518098) | 3518098..3518238 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
P8I09_RS17375 (3518244) | 3518244..3518504 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
P8I09_RS17380 (3518729) | 3518729..3520279 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
P8I09_RS17390 (3520510) | 3520510..3520899 | + | 390 | WP_000961285.1 | MGMT family protein | - |
P8I09_RS17395 (3520932) | 3520932..3521501 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T275544 WP_001280991.1 NZ_CP121066:3516506-3516724 [Salmonella enterica subsp. enterica serovar Infantis]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT275544 WP_000344807.1 NZ_CP121066:3516104-3516478 [Salmonella enterica subsp. enterica serovar Infantis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|