Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 3093869..3094512 | Replicon | chromosome |
| Accession | NZ_CP121066 | ||
| Organism | Salmonella enterica subsp. enterica serovar Infantis strain R21.0914 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B1LRW4 |
| Locus tag | P8I09_RS15180 | Protein ID | WP_001044768.1 |
| Coordinates | 3094096..3094512 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D2WFK3 |
| Locus tag | P8I09_RS15175 | Protein ID | WP_001261287.1 |
| Coordinates | 3093869..3094099 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8I09_RS15160 (3089980) | 3089980..3091068 | + | 1089 | WP_000952231.1 | hypothetical protein | - |
| P8I09_RS15165 (3091070) | 3091070..3091939 | + | 870 | WP_000253407.1 | hypothetical protein | - |
| P8I09_RS15170 (3091996) | 3091996..3093561 | - | 1566 | WP_000741348.1 | AAA family ATPase | - |
| P8I09_RS15175 (3093869) | 3093869..3094099 | + | 231 | WP_001261287.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| P8I09_RS15180 (3094096) | 3094096..3094512 | + | 417 | WP_001044768.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P8I09_RS15185 (3094674) | 3094674..3096812 | - | 2139 | WP_075322282.1 | AAA family ATPase | - |
| P8I09_RS15190 (3097166) | 3097166..3097423 | + | 258 | WP_000343085.1 | hypothetical protein | - |
| P8I09_RS15195 (3097423) | 3097423..3098013 | + | 591 | WP_000194575.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | ant(3'')-Ia / qacE / sul1 / tet(A) | - | 2913598..3095444 | 181846 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15197.66 Da Isoelectric Point: 7.7805
>T275543 WP_001044768.1 NZ_CP121066:3094096-3094512 [Salmonella enterica subsp. enterica serovar Infantis]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDEFCARLDAILPWDRA
AVDATTKIKVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPDLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A606Q844 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QFC4 |