Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | stbDE/ParE-YafN |
Location | 2359593..2360115 | Replicon | chromosome |
Accession | NZ_CP121066 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain R21.0914 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | B5F5Y5 |
Locus tag | P8I09_RS11470 | Protein ID | WP_000221343.1 |
Coordinates | 2359831..2360115 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | stbD | Uniprot ID | A0A5X3FYG4 |
Locus tag | P8I09_RS11465 | Protein ID | WP_000885426.1 |
Coordinates | 2359593..2359841 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8I09_RS11435 (2355017) | 2355017..2355997 | - | 981 | WP_023993266.1 | nitronate monooxygenase | - |
P8I09_RS11440 (2356171) | 2356171..2357079 | - | 909 | WP_242211998.1 | LysR family transcriptional regulator | - |
P8I09_RS11445 (2357985) | 2357985..2358431 | + | 447 | Protein_2236 | helix-turn-helix domain-containing protein | - |
P8I09_RS11450 (2358430) | 2358430..2358624 | - | 195 | Protein_2237 | hypothetical protein | - |
P8I09_RS11455 (2358904) | 2358904..2359236 | - | 333 | WP_000253154.1 | DUF1493 family protein | - |
P8I09_RS11460 (2359226) | 2359226..2359441 | - | 216 | WP_023993263.1 | phage protein | - |
P8I09_RS11465 (2359593) | 2359593..2359841 | + | 249 | WP_000885426.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P8I09_RS11470 (2359831) | 2359831..2360115 | + | 285 | WP_000221343.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P8I09_RS11475 (2360286) | 2360286..2360675 | + | 390 | WP_023993262.1 | RidA family protein | - |
P8I09_RS11480 (2360723) | 2360723..2361802 | - | 1080 | WP_023993261.1 | S-adenosylmethionine:tRNA ribosyltransferase-isomerase | - |
P8I09_RS11485 (2361995) | 2361995..2362483 | - | 489 | WP_001293634.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
P8I09_RS11490 (2362528) | 2362528..2364036 | + | 1509 | WP_023993260.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2353288..2366893 | 13605 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11075.85 Da Isoelectric Point: 10.6500
>T275542 WP_000221343.1 NZ_CP121066:2359831-2360115 [Salmonella enterica subsp. enterica serovar Infantis]
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
MTYKLAFNESALKEWKKLGHTIQEQFKKKLRERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYSVEDEIITVTVIGVGK
RENDAVYKMTRHRS
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JSW4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5X3FYG4 |