Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 846638..847298 | Replicon | chromosome |
Accession | NZ_CP121066 | ||
Organism | Salmonella enterica subsp. enterica serovar Infantis strain R21.0914 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A5I5GR00 |
Locus tag | P8I09_RS04065 | Protein ID | WP_000244761.1 |
Coordinates | 846885..847298 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | P8I09_RS04060 | Protein ID | WP_000351186.1 |
Coordinates | 846638..846904 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8I09_RS04040 (842567) | 842567..844000 | - | 1434 | WP_001230139.1 | 6-phospho-beta-glucosidase BglA | - |
P8I09_RS04045 (844158) | 844158..844469 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
P8I09_RS04050 (844633) | 844633..845292 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
P8I09_RS04055 (845408) | 845408..846388 | - | 981 | WP_023260866.1 | tRNA-modifying protein YgfZ | - |
P8I09_RS04060 (846638) | 846638..846904 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
P8I09_RS04065 (846885) | 846885..847298 | + | 414 | WP_000244761.1 | protein YgfX | Toxin |
P8I09_RS04070 (847351) | 847351..847872 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
P8I09_RS04075 (847985) | 847985..848881 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
P8I09_RS04080 (848905) | 848905..849618 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P8I09_RS04085 (849624) | 849624..851357 | + | 1734 | WP_000813387.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16199.15 Da Isoelectric Point: 10.7537
>T275536 WP_000244761.1 NZ_CP121066:846885-847298 [Salmonella enterica subsp. enterica serovar Infantis]
VVLWQSDLRVSWRAQWISLLIHGLVSAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVSAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Download Length: 89 a.a. Molecular weight: 10550.05 Da Isoelectric Point: 6.0783
>AT275536 WP_000351186.1 NZ_CP121066:846638-846904 [Salmonella enterica subsp. enterica serovar Infantis]
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
MDIHNKARIHWACRRGMRELDISIMPFFEHEYDSLSDEEKRIFVRLLQSDDPDLFNWLMNHGKPADAELEQMVRLIQTRN
RERGPVAI
Download Length: 267 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I5GR00 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |