Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 22948..23473 Replicon plasmid unnamed1
Accession NZ_CP121004
Organism Salmonella enterica strain 31A

Toxin (Protein)


Gene name ccdB Uniprot ID I3W3D5
Locus tag P6590_RS22885 Protein ID WP_001159863.1
Coordinates 22948..23253 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7S5D0
Locus tag P6590_RS22890 Protein ID WP_000813641.1
Coordinates 23255..23473 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6590_RS22845 18327..18887 - 561 WP_000900095.1 inverse autotransporter beta domain-containing protein -
P6590_RS22850 19043..19330 + 288 WP_071530243.1 hypothetical protein -
P6590_RS22855 19607..20092 - 486 WP_000905606.1 membrane protein -
P6590_RS22860 20086..20574 - 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
P6590_RS22865 20599..21312 - 714 WP_000545756.1 EAL domain-containing protein -
P6590_RS22870 21321..22103 - 783 WP_000082169.1 site-specific integrase -
P6590_RS22875 22138..22659 - 522 WP_000198608.1 hypothetical protein -
P6590_RS22880 22656..22946 - 291 WP_001266176.1 hypothetical protein -
P6590_RS22885 22948..23253 - 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB Toxin
P6590_RS22890 23255..23473 - 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
P6590_RS22895 24149..24670 + 522 WP_077681952.1 hypothetical protein -
P6590_RS22900 24714..25142 - 429 Protein_31 hypothetical protein -
P6590_RS22905 25154..25449 + 296 Protein_32 cytoplasmic protein -
P6590_RS22910 25943..26932 + 990 WP_000461382.1 RepB family plasmid replication initiator protein -
P6590_RS22915 27301..27420 - 120 Protein_34 recombinase -
P6590_RS22920 27473..27859 - 387 WP_000751876.1 YgiW/YdeI family stress tolerance OB fold protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-1B spvB / spvC / fdeC / pefB / pefA / pefC / pefD / rck 1..64327 64327


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11587.48 Da        Isoelectric Point: 6.9787

>T275532 WP_001159863.1 NZ_CP121004:c23253-22948 [Salmonella enterica]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8314.16 Da        Isoelectric Point: 4.5203

>AT275532 WP_000813641.1 NZ_CP121004:c23473-23255 [Salmonella enterica]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADDNRNW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB I3W3D5

Antitoxin

Source ID Structure
AlphaFold DB A0A656ICA6

References