Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4179224..4180005 | Replicon | chromosome |
Accession | NZ_CP121003 | ||
Organism | Salmonella enterica strain 31A |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | B5R980 |
Locus tag | P6590_RS20455 | Protein ID | WP_000626100.1 |
Coordinates | 4179224..4179715 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | P6590_RS20460 | Protein ID | WP_001110452.1 |
Coordinates | 4179712..4180005 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6590_RS20420 (4174684) | 4174684..4175031 | + | 348 | WP_000887832.1 | divalent cation tolerance protein CutA | - |
P6590_RS20425 (4175007) | 4175007..4176710 | + | 1704 | WP_000068885.1 | protein-disulfide reductase DsbD | - |
P6590_RS20430 (4176747) | 4176747..4177322 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
P6590_RS20440 (4177593) | 4177593..4177667 | - | 75 | Protein_3994 | helix-turn-helix domain-containing protein | - |
P6590_RS20445 (4178047) | 4178047..4178124 | + | 78 | Protein_3995 | porin family protein | - |
P6590_RS20450 (4178224) | 4178224..4178976 | + | 753 | WP_000842433.1 | non-specific acid phosphatase | - |
P6590_RS20455 (4179224) | 4179224..4179715 | - | 492 | WP_000626100.1 | GNAT family N-acetyltransferase | Toxin |
P6590_RS20460 (4179712) | 4179712..4180005 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
P6590_RS20465 (4180322) | 4180322..4180543 | + | 222 | WP_001576552.1 | hypothetical protein | - |
P6590_RS20470 (4180809) | 4180809..4181684 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
P6590_RS20475 (4181681) | 4181681..4181968 | + | 288 | WP_001541332.1 | transcriptional regulator RtsB | - |
P6590_RS20480 (4181961) | 4181961..4182269 | - | 309 | WP_072095651.1 | ABC transporter ATP-binding protein | - |
P6590_RS20485 (4182268) | 4182268..4182516 | + | 249 | Protein_4003 | Ig-like domain-containing protein | - |
P6590_RS20490 (4182628) | 4182628..4182759 | + | 132 | Protein_4004 | hypothetical protein | - |
P6590_RS20495 (4183053) | 4183053..4183958 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17645.45 Da Isoelectric Point: 7.7297
>T275529 WP_000626100.1 NZ_CP121003:c4179715-4179224 [Salmonella enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A656IQ80 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |