Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 4031203..4031753 | Replicon | chromosome |
| Accession | NZ_CP121003 | ||
| Organism | Salmonella enterica strain 31A | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | M7RJ32 |
| Locus tag | P6590_RS19675 | Protein ID | WP_001199743.1 |
| Coordinates | 4031203..4031511 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | M7RP97 |
| Locus tag | P6590_RS19680 | Protein ID | WP_001118105.1 |
| Coordinates | 4031514..4031753 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6590_RS19655 (4027777) | 4027777..4028517 | - | 741 | WP_001676217.1 | SEF14/SEF18 fimbria chaperone SefB | - |
| P6590_RS19660 (4028639) | 4028639..4029169 | - | 531 | WP_000909461.1 | SEF14 fimbria major subunit SefA | - |
| P6590_RS19665 (4029492) | 4029492..4030625 | + | 1134 | Protein_3844 | IS3 family transposase | - |
| P6590_RS19670 (4030657) | 4030657..4030797 | - | 141 | Protein_3845 | Arm DNA-binding domain-containing protein | - |
| P6590_RS19675 (4031203) | 4031203..4031511 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
| P6590_RS19680 (4031514) | 4031514..4031753 | - | 240 | WP_001118105.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| P6590_RS19685 (4031862) | 4031862..4032110 | - | 249 | WP_000168388.1 | ribbon-helix-helix domain-containing protein | - |
| P6590_RS19690 (4032187) | 4032187..4032732 | - | 546 | WP_223151225.1 | helix-turn-helix domain-containing protein | - |
| P6590_RS19700 (4033489) | 4033489..4034508 | + | 1020 | WP_000152558.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| P6590_RS19705 (4034536) | 4034536..4035066 | - | 531 | WP_000896758.1 | gluconokinase | - |
| P6590_RS19710 (4035283) | 4035283..4036314 | + | 1032 | WP_000453347.1 | L-idonate 5-dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 4029584..4032687 | 3103 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T275527 WP_001199743.1 NZ_CP121003:c4031511-4031203 [Salmonella enterica]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H9SZK8 |