Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 825015..825675 | Replicon | chromosome |
Accession | NZ_CP121003 | ||
Organism | Salmonella enterica strain 31A |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q57K70 |
Locus tag | P6590_RS03965 | Protein ID | WP_000244756.1 |
Coordinates | 825262..825675 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S5MU13 |
Locus tag | P6590_RS03960 | Protein ID | WP_000351186.1 |
Coordinates | 825015..825281 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6590_RS03940 (820944) | 820944..822377 | - | 1434 | WP_001230141.1 | 6-phospho-beta-glucosidase BglA | - |
P6590_RS03945 (822535) | 822535..822846 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
P6590_RS03950 (823010) | 823010..823669 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
P6590_RS03955 (823785) | 823785..824765 | - | 981 | WP_000874176.1 | tRNA-modifying protein YgfZ | - |
P6590_RS03960 (825015) | 825015..825281 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
P6590_RS03965 (825262) | 825262..825675 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
P6590_RS03970 (825728) | 825728..826249 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
P6590_RS03975 (826362) | 826362..827258 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
P6590_RS03980 (827282) | 827282..827995 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P6590_RS03985 (828001) | 828001..829734 | + | 1734 | WP_000813389.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T275515 WP_000244756.1 NZ_CP121003:825262-825675 [Salmonella enterica]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I0YWH4 |