Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 310301..310887 Replicon chromosome
Accession NZ_CP121003
Organism Salmonella enterica strain 31A

Toxin (Protein)


Gene name doc Uniprot ID A0A3V9X0E4
Locus tag P6590_RS01415 Protein ID WP_000174964.1
Coordinates 310519..310887 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID V7IU48
Locus tag P6590_RS01410 Protein ID WP_001522145.1
Coordinates 310301..310522 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6590_RS01385 (305322) 305322..306431 + 1110 WP_000822978.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
P6590_RS01390 (306491) 306491..307417 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
P6590_RS01395 (307414) 307414..308691 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
P6590_RS01400 (308688) 308688..309455 + 768 WP_000082080.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
P6590_RS01405 (309457) 309457..310170 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
P6590_RS01410 (310301) 310301..310522 + 222 WP_001522145.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P6590_RS01415 (310519) 310519..310887 + 369 WP_000174964.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
P6590_RS01420 (311146) 311146..312462 + 1317 WP_000624755.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
P6590_RS01425 (312567) 312567..313454 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
P6590_RS01430 (313451) 313451..314296 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
P6590_RS01435 (314298) 314298..315368 + 1071 WP_000907840.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 307414..316105 8691


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-114)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13601.91 Da        Isoelectric Point: 6.7252

>T275513 WP_000174964.1 NZ_CP121003:310519-310887 [Salmonella enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8166.17 Da        Isoelectric Point: 5.0775

>AT275513 WP_001522145.1 NZ_CP121003:310301-310522 [Salmonella enterica]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3V9X0E4

Antitoxin

Source ID Structure

References