Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 200172..200932 | Replicon | chromosome |
Accession | NZ_CP121003 | ||
Organism | Salmonella enterica strain 31A |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A1R2W0C7 |
Locus tag | P6590_RS00930 | Protein ID | WP_000533912.1 |
Coordinates | 200447..200932 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | M7RHS4 |
Locus tag | P6590_RS00925 | Protein ID | WP_000965886.1 |
Coordinates | 200172..200459 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6590_RS00905 (195577) | 195577..196488 | + | 912 | WP_001168551.1 | glycine--tRNA ligase subunit alpha | - |
P6590_RS00910 (196498) | 196498..198567 | + | 2070 | WP_001291741.1 | glycine--tRNA ligase subunit beta | - |
P6590_RS00915 (198957) | 198957..199355 | + | 399 | Protein_181 | IS3 family transposase | - |
P6590_RS00920 (199527) | 199527..199994 | + | 468 | WP_000702452.1 | GNAT family N-acetyltransferase | - |
P6590_RS00925 (200172) | 200172..200459 | + | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
P6590_RS00930 (200447) | 200447..200932 | + | 486 | WP_000533912.1 | GNAT family N-acetyltransferase | Toxin |
P6590_RS00935 (201303) | 201303..201842 | - | 540 | WP_000047147.1 | copper-binding periplasmic metallochaperone CueP | - |
P6590_RS00940 (202016) | 202016..202228 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
P6590_RS00945 (202516) | 202516..202806 | - | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
P6590_RS00950 (203245) | 203245..203955 | + | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
P6590_RS00955 (204005) | 204005..204979 | - | 975 | WP_000804678.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
P6590_RS00960 (205198) | 205198..205860 | - | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17731.46 Da Isoelectric Point: 9.8719
>T275512 WP_000533912.1 NZ_CP121003:200447-200932 [Salmonella enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEVTGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEVTGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1R2W0C7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK8 | |
AlphaFold DB | A0A3V2JDX2 |