Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 274250..274958 | Replicon | plasmid pXJ22MSE3-1 |
Accession | NZ_CP120979 | ||
Organism | Moellerella wisconsensis strain XJ22MSE3 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | P8A17_RS17355 | Protein ID | WP_241502024.1 |
Coordinates | 274569..274958 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A4D7IVZ1 |
Locus tag | P8A17_RS17350 | Protein ID | WP_067421833.1 |
Coordinates | 274250..274579 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8A17_RS17325 | 269986..270267 | + | 282 | WP_137022554.1 | hypothetical protein | - |
P8A17_RS17330 | 270481..271545 | + | 1065 | WP_241502022.1 | hypothetical protein | - |
P8A17_RS17335 | 271754..272305 | + | 552 | WP_137022556.1 | hypothetical protein | - |
P8A17_RS17340 | 272393..274042 | + | 1650 | WP_241502023.1 | ATP-binding protein | - |
P8A17_RS17345 | 274029..274211 | + | 183 | WP_137022558.1 | hypothetical protein | - |
P8A17_RS17350 | 274250..274579 | - | 330 | WP_067421833.1 | helix-turn-helix domain-containing protein | Antitoxin |
P8A17_RS17355 | 274569..274958 | - | 390 | WP_241502024.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P8A17_RS17360 | 275101..275709 | + | 609 | WP_137022560.1 | hypothetical protein | - |
P8A17_RS17365 | 275763..276983 | + | 1221 | WP_277850695.1 | hypothetical protein | - |
P8A17_RS17370 | 277076..277522 | + | 447 | WP_137022562.1 | hypothetical protein | - |
P8A17_RS17375 | 277567..277707 | + | 141 | WP_175403207.1 | hypothetical protein | - |
P8A17_RS17380 | 277742..278056 | + | 315 | WP_241502025.1 | hypothetical protein | - |
P8A17_RS17385 | 278060..278404 | + | 345 | WP_277850696.1 | hypothetical protein | - |
P8A17_RS17390 | 278502..279332 | + | 831 | WP_277850697.1 | TnsA endonuclease N-terminal domain-containing protein | - |
P8A17_RS17395 | 279319..279735 | + | 417 | WP_277850698.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | lnu(G) / ant(2'')-Ia / catB8 / blaOXA-10 / ant(3'')-Ia / dfrA1 / qacE / sul1 / blaNDM-1 / mph(E) / msr(E) / fosA3 / aph(3')-Ia / qnrA1 / ARR-3 / aac(6')-Ib-cr / floR / aph(4)-Ia / aac(3)-IVa | - | 1..325408 | 325408 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14451.50 Da Isoelectric Point: 6.4817
>T275511 WP_241502024.1 NZ_CP120979:c274958-274569 [Moellerella wisconsensis]
VAFYKISSFVRSTKKIPITDKQLLDAAHEVQQGQFEADLGGGVIKKRLAMKGQGKSGSVRVIIFFKINNHLFFADGWTKN
TVNAKGTKEIEDDELETYKKLAAEFLNFDGEIINNLISKGILEEITDEQ
VAFYKISSFVRSTKKIPITDKQLLDAAHEVQQGQFEADLGGGVIKKRLAMKGQGKSGSVRVIIFFKINNHLFFADGWTKN
TVNAKGTKEIEDDELETYKKLAAEFLNFDGEIINNLISKGILEEITDEQ
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|