Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 129909..130486 | Replicon | plasmid pXJ22MSE3-1 |
Accession | NZ_CP120979 | ||
Organism | Moellerella wisconsensis strain XJ22MSE3 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | U5N651 |
Locus tag | P8A17_RS16510 | Protein ID | WP_023159957.1 |
Coordinates | 129909..130241 (-) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | U5N340 |
Locus tag | P8A17_RS16515 | Protein ID | WP_023159984.1 |
Coordinates | 130241..130486 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8A17_RS16475 | 125075..125893 | - | 819 | WP_241543873.1 | DUF4365 domain-containing protein | - |
P8A17_RS16480 | 125909..126862 | - | 954 | WP_166268230.1 | site-specific integrase | - |
P8A17_RS16485 | 127223..128029 | + | 807 | WP_277850720.1 | type I restriction endonuclease | - |
P8A17_RS16490 | 128110..128247 | + | 138 | Protein_160 | HdeA/HdeB family chaperone | - |
P8A17_RS16495 | 128255..128893 | + | 639 | WP_277850716.1 | GAD-like domain-containing protein | - |
P8A17_RS16500 | 128909..129538 | + | 630 | WP_241501932.1 | GAD-like domain-containing protein | - |
P8A17_RS16505 | 129605..129934 | + | 330 | WP_241501933.1 | SMI1/KNR4 family protein | - |
P8A17_RS16510 | 129909..130241 | - | 333 | WP_023159957.1 | endoribonuclease MazF | Toxin |
P8A17_RS16515 | 130241..130486 | - | 246 | WP_023159984.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
P8A17_RS16520 | 130737..131360 | + | 624 | WP_023159958.1 | AAA family ATPase | - |
P8A17_RS16525 | 131493..131720 | + | 228 | WP_048821767.1 | plasmid partition protein ParG | - |
P8A17_RS16530 | 131812..132573 | - | 762 | WP_241501934.1 | IS5 family transposase | - |
P8A17_RS16535 | 133215..134480 | + | 1266 | WP_277850717.1 | integrase arm-type DNA-binding domain-containing protein | - |
P8A17_RS16540 | 134736..135020 | + | 285 | WP_004917096.1 | membrane protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | lnu(G) / ant(2'')-Ia / catB8 / blaOXA-10 / ant(3'')-Ia / dfrA1 / qacE / sul1 / blaNDM-1 / mph(E) / msr(E) / fosA3 / aph(3')-Ia / qnrA1 / ARR-3 / aac(6')-Ib-cr / floR / aph(4)-Ia / aac(3)-IVa | - | 1..325408 | 325408 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12097.88 Da Isoelectric Point: 7.0813
>T275510 WP_023159957.1 NZ_CP120979:c130241-129909 [Moellerella wisconsensis]
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTCV
DWRARKVTKKGKVEASELAEIKAKAKALIG
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTCV
DWRARKVTKKGKVEASELAEIKAKAKALIG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P1BQ75 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A857E7M9 |