Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pasABC/RelE-HTH |
| Location | 3132409..3132883 | Replicon | chromosome |
| Accession | NZ_CP120978 | ||
| Organism | Moellerella wisconsensis strain XJ22MSE3 | ||
Toxin (Protein)
| Gene name | pasB | Uniprot ID | - |
| Locus tag | P8A17_RS13745 | Protein ID | WP_047257106.1 |
| Coordinates | 3132409..3132675 (-) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | pasA | Uniprot ID | - |
| Locus tag | P8A17_RS13750 | Protein ID | WP_047257105.1 |
| Coordinates | 3132659..3132883 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8A17_RS13725 | 3127729..3128643 | - | 915 | WP_277850218.1 | ribonuclease Z | - |
| P8A17_RS13730 | 3128673..3130274 | - | 1602 | WP_277850219.1 | RNA repair transcriptional activator RtcR | - |
| P8A17_RS13735 | 3130558..3130773 | + | 216 | WP_047257108.1 | hypothetical protein | - |
| P8A17_RS13740 | 3130795..3131922 | + | 1128 | WP_047257107.1 | slipin family protein | - |
| P8A17_RS13745 | 3132409..3132675 | - | 267 | WP_047257106.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P8A17_RS13750 | 3132659..3132883 | - | 225 | WP_047257105.1 | TraY domain-containing protein | Antitoxin |
| P8A17_RS13755 | 3133073..3133201 | + | 129 | WP_269430907.1 | hypothetical protein | - |
| P8A17_RS13765 | 3134688..3135464 | - | 777 | WP_277850221.1 | hypothetical protein | - |
| P8A17_RS13770 | 3135667..3135885 | - | 219 | WP_277850222.1 | hypothetical protein | - |
| P8A17_RS13775 | 3136123..3136899 | - | 777 | WP_277850223.1 | hypothetical protein | - |
| P8A17_RS13780 | 3136880..3137053 | - | 174 | WP_277850224.1 | hypothetical protein | - |
| P8A17_RS13785 | 3137102..3137284 | - | 183 | WP_277850225.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3133280..3134083 | 803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10416.09 Da Isoelectric Point: 9.5211
>T275508 WP_047257106.1 NZ_CP120978:c3132675-3132409 [Moellerella wisconsensis]
MVWTINYSERALKSLRKMDKQSARRIVDFMGLRIAALDDPRQLGKSLKGELGEFWRYRVGDYRILCEIRDDELVILAATI
GHRREIYE
MVWTINYSERALKSLRKMDKQSARRIVDFMGLRIAALDDPRQLGKSLKGELGEFWRYRVGDYRILCEIRDDELVILAATI
GHRREIYE
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|