Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 274242..274950 | Replicon | plasmid pXJ22MSE2-1 |
| Accession | NZ_CP120975 | ||
| Organism | Moellerella wisconsensis strain XJ22MSE2 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | P8A16_RS17360 | Protein ID | WP_241502024.1 |
| Coordinates | 274561..274950 (-) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A4D7IVZ1 |
| Locus tag | P8A16_RS17355 | Protein ID | WP_067421833.1 |
| Coordinates | 274242..274571 (-) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8A16_RS17330 | 269978..270259 | + | 282 | WP_137022554.1 | hypothetical protein | - |
| P8A16_RS17335 | 270473..271537 | + | 1065 | WP_241502022.1 | hypothetical protein | - |
| P8A16_RS17340 | 271746..272297 | + | 552 | WP_137022556.1 | hypothetical protein | - |
| P8A16_RS17345 | 272385..274034 | + | 1650 | WP_241502023.1 | ATP-binding protein | - |
| P8A16_RS17350 | 274021..274203 | + | 183 | WP_137022558.1 | hypothetical protein | - |
| P8A16_RS17355 | 274242..274571 | - | 330 | WP_067421833.1 | helix-turn-helix domain-containing protein | Antitoxin |
| P8A16_RS17360 | 274561..274950 | - | 390 | WP_241502024.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P8A16_RS17365 | 275093..275701 | + | 609 | WP_137022560.1 | hypothetical protein | - |
| P8A16_RS17370 | 275755..276975 | + | 1221 | WP_277850695.1 | hypothetical protein | - |
| P8A16_RS17375 | 277068..277514 | + | 447 | WP_137022562.1 | hypothetical protein | - |
| P8A16_RS17380 | 277559..277699 | + | 141 | WP_175403207.1 | hypothetical protein | - |
| P8A16_RS17385 | 277734..278048 | + | 315 | WP_241502025.1 | hypothetical protein | - |
| P8A16_RS17390 | 278052..278396 | + | 345 | WP_277850696.1 | hypothetical protein | - |
| P8A16_RS17395 | 278494..279324 | + | 831 | WP_277850697.1 | TnsA endonuclease N-terminal domain-containing protein | - |
| P8A16_RS17400 | 279311..279727 | + | 417 | WP_277850698.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | lnu(G) / ant(2'')-Ia / catB8 / blaOXA-10 / ant(3'')-Ia / dfrA1 / qacE / sul1 / blaNDM-1 / mph(E) / msr(E) / fosA3 / aph(3')-Ia / qnrA1 / ARR-3 / aac(6')-Ib-cr / floR / aph(4)-Ia / aac(3)-IVa | - | 1..325400 | 325400 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14451.50 Da Isoelectric Point: 6.4817
>T275504 WP_241502024.1 NZ_CP120975:c274950-274561 [Moellerella wisconsensis]
VAFYKISSFVRSTKKIPITDKQLLDAAHEVQQGQFEADLGGGVIKKRLAMKGQGKSGSVRVIIFFKINNHLFFADGWTKN
TVNAKGTKEIEDDELETYKKLAAEFLNFDGEIINNLISKGILEEITDEQ
VAFYKISSFVRSTKKIPITDKQLLDAAHEVQQGQFEADLGGGVIKKRLAMKGQGKSGSVRVIIFFKINNHLFFADGWTKN
TVNAKGTKEIEDDELETYKKLAAEFLNFDGEIINNLISKGILEEITDEQ
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|