Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-HTH_XRE
Location 274242..274950 Replicon plasmid pXJ22MSE2-1
Accession NZ_CP120975
Organism Moellerella wisconsensis strain XJ22MSE2

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag P8A16_RS17360 Protein ID WP_241502024.1
Coordinates 274561..274950 (-) Length 130 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A4D7IVZ1
Locus tag P8A16_RS17355 Protein ID WP_067421833.1
Coordinates 274242..274571 (-) Length 110 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8A16_RS17330 269978..270259 + 282 WP_137022554.1 hypothetical protein -
P8A16_RS17335 270473..271537 + 1065 WP_241502022.1 hypothetical protein -
P8A16_RS17340 271746..272297 + 552 WP_137022556.1 hypothetical protein -
P8A16_RS17345 272385..274034 + 1650 WP_241502023.1 ATP-binding protein -
P8A16_RS17350 274021..274203 + 183 WP_137022558.1 hypothetical protein -
P8A16_RS17355 274242..274571 - 330 WP_067421833.1 helix-turn-helix domain-containing protein Antitoxin
P8A16_RS17360 274561..274950 - 390 WP_241502024.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P8A16_RS17365 275093..275701 + 609 WP_137022560.1 hypothetical protein -
P8A16_RS17370 275755..276975 + 1221 WP_277850695.1 hypothetical protein -
P8A16_RS17375 277068..277514 + 447 WP_137022562.1 hypothetical protein -
P8A16_RS17380 277559..277699 + 141 WP_175403207.1 hypothetical protein -
P8A16_RS17385 277734..278048 + 315 WP_241502025.1 hypothetical protein -
P8A16_RS17390 278052..278396 + 345 WP_277850696.1 hypothetical protein -
P8A16_RS17395 278494..279324 + 831 WP_277850697.1 TnsA endonuclease N-terminal domain-containing protein -
P8A16_RS17400 279311..279727 + 417 WP_277850698.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid lnu(G) / ant(2'')-Ia / catB8 / blaOXA-10 / ant(3'')-Ia / dfrA1 / qacE / sul1 / blaNDM-1 / mph(E) / msr(E) / fosA3 / aph(3')-Ia / qnrA1 / ARR-3 / aac(6')-Ib-cr / floR / aph(4)-Ia / aac(3)-IVa - 1..325400 325400


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(4-125)

Antitoxin

Cro/C1-type helix-turn-helix domain

(53-93)


Sequences

Toxin        


Download         Length: 130 a.a.        Molecular weight: 14451.50 Da        Isoelectric Point: 6.4817

>T275504 WP_241502024.1 NZ_CP120975:c274950-274561 [Moellerella wisconsensis]
VAFYKISSFVRSTKKIPITDKQLLDAAHEVQQGQFEADLGGGVIKKRLAMKGQGKSGSVRVIIFFKINNHLFFADGWTKN
TVNAKGTKEIEDDELETYKKLAAEFLNFDGEIINNLISKGILEEITDEQ

Download         Length: 390 bp

Antitoxin


Download         Length: 110 a.a.        Molecular weight: 12062.15 Da        Isoelectric Point: 10.2039

>AT275504 WP_067421833.1 NZ_CP120975:c274571-274242 [Moellerella wisconsensis]
MNNKLNNMLELAKELNAAGASPESLVKDIESTIRAREINDKIKEVSAMSGSEIKMLRTKYCMSQSVLARALGMSKESISK
WERGEKKPSGPALRMLRILESKGPEVLVV

Download         Length: 330 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4D7IVZ1

References