Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 129909..130486 Replicon plasmid pXJ22MSE2-1
Accession NZ_CP120975
Organism Moellerella wisconsensis strain XJ22MSE2

Toxin (Protein)


Gene name mazF Uniprot ID U5N651
Locus tag P8A16_RS16515 Protein ID WP_023159957.1
Coordinates 129909..130241 (-) Length 111 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID U5N340
Locus tag P8A16_RS16520 Protein ID WP_023159984.1
Coordinates 130241..130486 (-) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8A16_RS16480 125075..125893 - 819 WP_241543873.1 DUF4365 domain-containing protein -
P8A16_RS16485 125909..126862 - 954 WP_166268230.1 site-specific integrase -
P8A16_RS16490 127223..128029 + 807 WP_277850720.1 type I restriction endonuclease -
P8A16_RS16495 128110..128247 + 138 Protein_160 HdeA/HdeB family chaperone -
P8A16_RS16500 128255..128893 + 639 WP_277850716.1 GAD-like domain-containing protein -
P8A16_RS16505 128909..129538 + 630 WP_241501932.1 GAD-like domain-containing protein -
P8A16_RS16510 129605..129934 + 330 WP_241501933.1 SMI1/KNR4 family protein -
P8A16_RS16515 129909..130241 - 333 WP_023159957.1 endoribonuclease MazF Toxin
P8A16_RS16520 130241..130486 - 246 WP_023159984.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
P8A16_RS16525 130737..131360 + 624 WP_023159958.1 AAA family ATPase -
P8A16_RS16530 131485..131712 + 228 WP_048821767.1 plasmid partition protein ParG -
P8A16_RS16535 131804..132565 - 762 WP_241501934.1 IS5 family transposase -
P8A16_RS16540 133207..134472 + 1266 WP_277850717.1 integrase arm-type DNA-binding domain-containing protein -
P8A16_RS16545 134728..135012 + 285 WP_004917096.1 membrane protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid lnu(G) / ant(2'')-Ia / catB8 / blaOXA-10 / ant(3'')-Ia / dfrA1 / qacE / sul1 / blaNDM-1 / mph(E) / msr(E) / fosA3 / aph(3')-Ia / qnrA1 / ARR-3 / aac(6')-Ib-cr / floR / aph(4)-Ia / aac(3)-IVa - 1..325400 325400


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(9-107)

Antitoxin

SpoVT-AbrB domain

(7-49)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 12097.88 Da        Isoelectric Point: 7.0813

>T275503 WP_023159957.1 NZ_CP120975:c130241-129909 [Moellerella wisconsensis]
MVSRYVPDSGDLIWIDFDPVEGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTKGKGYPFECELSNERDSYALADQVTCV
DWRARKVTKKGKVEASELAEIKAKAKALIG

Download         Length: 333 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8786.20 Da        Isoelectric Point: 5.0351

>AT275503 WP_023159984.1 NZ_CP120975:c130486-130241 [Moellerella wisconsensis]
MAQVTVKKWGNSPSVRLPVAIMQKAALSVDDTVEIAVEEGRIIITPVKAVEYSLDNLLAGITPENIHEKVDFGARTGKEL
I

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P1BQ75

Antitoxin

Source ID Structure
AlphaFold DB A0A857E7M9

References