Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-HTH_XRE
Location 274250..274958 Replicon plasmid pXJ22MSE1-1
Accession NZ_CP120971
Organism Moellerella wisconsensis strain XJ22MSE1

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag P6F44_RS17360 Protein ID WP_241502024.1
Coordinates 274569..274958 (-) Length 130 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A4D7IVZ1
Locus tag P6F44_RS17355 Protein ID WP_067421833.1
Coordinates 274250..274579 (-) Length 110 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6F44_RS17330 269986..270267 + 282 WP_137022554.1 hypothetical protein -
P6F44_RS17335 270481..271545 + 1065 WP_241502022.1 hypothetical protein -
P6F44_RS17340 271754..272305 + 552 WP_137022556.1 hypothetical protein -
P6F44_RS17345 272393..274042 + 1650 WP_241502023.1 ATP-binding protein -
P6F44_RS17350 274029..274211 + 183 WP_137022558.1 hypothetical protein -
P6F44_RS17355 274250..274579 - 330 WP_067421833.1 helix-turn-helix domain-containing protein Antitoxin
P6F44_RS17360 274569..274958 - 390 WP_241502024.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P6F44_RS17365 275101..275709 + 609 WP_137022560.1 hypothetical protein -
P6F44_RS17370 275763..276983 + 1221 WP_277850695.1 hypothetical protein -
P6F44_RS17375 277076..277522 + 447 WP_137022562.1 hypothetical protein -
P6F44_RS17380 277567..277707 + 141 WP_175403207.1 hypothetical protein -
P6F44_RS17385 277742..278056 + 315 WP_241502025.1 hypothetical protein -
P6F44_RS17390 278060..278404 + 345 WP_277850696.1 hypothetical protein -
P6F44_RS17395 278502..279332 + 831 WP_277850697.1 TnsA endonuclease N-terminal domain-containing protein -
P6F44_RS17400 279319..279735 + 417 WP_277850698.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid lnu(G) / ant(2'')-Ia / catB8 / blaOXA-10 / ant(3'')-Ia / dfrA1 / qacE / sul1 / blaNDM-1 / mph(E) / msr(E) / fosA3 / aph(3')-Ia / qnrA1 / ARR-3 / aac(6')-Ib-cr / floR / aph(4)-Ia / aac(3)-IVa - 1..325408 325408


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(4-125)

Antitoxin

Cro/C1-type helix-turn-helix domain

(53-93)


Sequences

Toxin        


Download         Length: 130 a.a.        Molecular weight: 14451.50 Da        Isoelectric Point: 6.4817

>T275497 WP_241502024.1 NZ_CP120971:c274958-274569 [Moellerella wisconsensis]
VAFYKISSFVRSTKKIPITDKQLLDAAHEVQQGQFEADLGGGVIKKRLAMKGQGKSGSVRVIIFFKINNHLFFADGWTKN
TVNAKGTKEIEDDELETYKKLAAEFLNFDGEIINNLISKGILEEITDEQ

Download         Length: 390 bp

Antitoxin


Download         Length: 110 a.a.        Molecular weight: 12062.15 Da        Isoelectric Point: 10.2039

>AT275497 WP_067421833.1 NZ_CP120971:c274579-274250 [Moellerella wisconsensis]
MNNKLNNMLELAKELNAAGASPESLVKDIESTIRAREINDKIKEVSAMSGSEIKMLRTKYCMSQSVLARALGMSKESISK
WERGEKKPSGPALRMLRILESKGPEVLVV

Download         Length: 330 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A4D7IVZ1

References