Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | pasABC/RelE-HTH |
Location | 3133263..3133737 | Replicon | chromosome |
Accession | NZ_CP120970 | ||
Organism | Moellerella wisconsensis strain XJ22MSE1 |
Toxin (Protein)
Gene name | pasB | Uniprot ID | - |
Locus tag | P6F44_RS13750 | Protein ID | WP_047257106.1 |
Coordinates | 3133263..3133529 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | - |
Locus tag | P6F44_RS13755 | Protein ID | WP_047257105.1 |
Coordinates | 3133513..3133737 (-) | Length | 75 a.a. |
Genomic Context
Location: 3131412..3131627 (216 bp)
Type: Others
Protein ID: WP_047257108.1
Type: Others
Protein ID: WP_047257108.1
Location: 3131649..3132776 (1128 bp)
Type: Others
Protein ID: WP_047257107.1
Type: Others
Protein ID: WP_047257107.1
Location: 3133927..3134055 (129 bp)
Type: Others
Protein ID: WP_269430907.1
Type: Others
Protein ID: WP_269430907.1
Location: 3128583..3129497 (915 bp)
Type: Others
Protein ID: WP_277850218.1
Type: Others
Protein ID: WP_277850218.1
Location: 3129527..3131128 (1602 bp)
Type: Others
Protein ID: WP_277850219.1
Type: Others
Protein ID: WP_277850219.1
Location: 3133263..3133529 (267 bp)
Type: Toxin
Protein ID: WP_047257106.1
Type: Toxin
Protein ID: WP_047257106.1
Location: 3133513..3133737 (225 bp)
Type: Antitoxin
Protein ID: WP_047257105.1
Type: Antitoxin
Protein ID: WP_047257105.1
Location: 3135542..3136318 (777 bp)
Type: Others
Protein ID: WP_277850221.1
Type: Others
Protein ID: WP_277850221.1
Location: 3136521..3136739 (219 bp)
Type: Others
Protein ID: WP_277850222.1
Type: Others
Protein ID: WP_277850222.1
Location: 3136977..3137753 (777 bp)
Type: Others
Protein ID: WP_277850223.1
Type: Others
Protein ID: WP_277850223.1
Location: 3137734..3137907 (174 bp)
Type: Others
Protein ID: WP_277850224.1
Type: Others
Protein ID: WP_277850224.1
Location: 3137956..3138138 (183 bp)
Type: Others
Protein ID: WP_277850225.1
Type: Others
Protein ID: WP_277850225.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6F44_RS13730 | 3128583..3129497 | - | 915 | WP_277850218.1 | ribonuclease Z | - |
P6F44_RS13735 | 3129527..3131128 | - | 1602 | WP_277850219.1 | RNA repair transcriptional activator RtcR | - |
P6F44_RS13740 | 3131412..3131627 | + | 216 | WP_047257108.1 | hypothetical protein | - |
P6F44_RS13745 | 3131649..3132776 | + | 1128 | WP_047257107.1 | slipin family protein | - |
P6F44_RS13750 | 3133263..3133529 | - | 267 | WP_047257106.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P6F44_RS13755 | 3133513..3133737 | - | 225 | WP_047257105.1 | TraY domain-containing protein | Antitoxin |
P6F44_RS13760 | 3133927..3134055 | + | 129 | WP_269430907.1 | hypothetical protein | - |
P6F44_RS13770 | 3135542..3136318 | - | 777 | WP_277850221.1 | hypothetical protein | - |
P6F44_RS13775 | 3136521..3136739 | - | 219 | WP_277850222.1 | hypothetical protein | - |
P6F44_RS13780 | 3136977..3137753 | - | 777 | WP_277850223.1 | hypothetical protein | - |
P6F44_RS13785 | 3137734..3137907 | - | 174 | WP_277850224.1 | hypothetical protein | - |
P6F44_RS13790 | 3137956..3138138 | - | 183 | WP_277850225.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 3134134..3134937 | 803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10416.09 Da Isoelectric Point: 9.5211
>T275494 WP_047257106.1 NZ_CP120970:c3133529-3133263 [Moellerella wisconsensis]
MVWTINYSERALKSLRKMDKQSARRIVDFMGLRIAALDDPRQLGKSLKGELGEFWRYRVGDYRILCEIRDDELVILAATI
GHRREIYE
MVWTINYSERALKSLRKMDKQSARRIVDFMGLRIAALDDPRQLGKSLKGELGEFWRYRVGDYRILCEIRDDELVILAATI
GHRREIYE
Download Length: 267 bp