Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 2876419..2877058 | Replicon | chromosome |
Accession | NZ_CP120970 | ||
Organism | Moellerella wisconsensis strain XJ22MSE1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | - |
Locus tag | P6F44_RS12745 | Protein ID | WP_269430900.1 |
Coordinates | 2876834..2877058 (+) | Length | 75 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | - |
Locus tag | P6F44_RS12740 | Protein ID | WP_047256412.1 |
Coordinates | 2876419..2876787 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6F44_RS12715 | 2871620..2872381 | - | 762 | WP_047256407.1 | DNA polymerase III subunit epsilon | - |
P6F44_RS12720 | 2872438..2872905 | + | 468 | WP_047256408.1 | ribonuclease HI | - |
P6F44_RS12725 | 2872908..2873624 | - | 717 | WP_047256409.1 | methyltransferase domain-containing protein | - |
P6F44_RS12730 | 2873659..2874414 | + | 756 | WP_047256410.1 | hydroxyacylglutathione hydrolase | - |
P6F44_RS12735 | 2874486..2875841 | + | 1356 | WP_047256411.1 | murein transglycosylase D | - |
P6F44_RS12740 | 2876419..2876787 | + | 369 | WP_047256412.1 | Hha toxicity modulator TomB | Antitoxin |
P6F44_RS12745 | 2876834..2877058 | + | 225 | WP_269430900.1 | HHA domain-containing protein | Toxin |
P6F44_RS12755 | 2877805..2878266 | - | 462 | WP_047256414.1 | YbaY family lipoprotein | - |
P6F44_RS12760 | 2878661..2879524 | + | 864 | WP_277850187.1 | acyl-CoA thioesterase II | - |
P6F44_RS12765 | 2880589..2881872 | - | 1284 | WP_047256416.1 | ammonium transporter AmtB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 75 a.a. Molecular weight: 8977.32 Da Isoelectric Point: 5.8622
>T275493 WP_269430900.1 NZ_CP120970:2876834-2877058 [Moellerella wisconsensis]
MNERQENMTKTDYLMRLRKCTTIETLERVIEKNKYELSDDELELFFSAADHRLAELTMNKLYDKIPASVWKYVR
MNERQENMTKTDYLMRLRKCTTIETLERVIEKNKYELSDDELELFFSAADHRLAELTMNKLYDKIPASVWKYVR
Download Length: 225 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14371.20 Da Isoelectric Point: 4.5817
>AT275493 WP_047256412.1 NZ_CP120970:2876419-2876787 [Moellerella wisconsensis]
MDEYSPRYYDTAELKYLCDSLNNDAILSLHKTKTHWINDLSSQQSTNLNELIEHVAAFFWKFKIKYPSERLVISLVDEYL
DETYNLFGSPLITLNEFSDWQKMNTHLIDELNNDLKCSVAKL
MDEYSPRYYDTAELKYLCDSLNNDAILSLHKTKTHWINDLSSQQSTNLNELIEHVAAFFWKFKIKYPSERLVISLVDEYL
DETYNLFGSPLITLNEFSDWQKMNTHLIDELNNDLKCSVAKL
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|