Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2470626..2471283 | Replicon | chromosome |
Accession | NZ_CP120970 | ||
Organism | Moellerella wisconsensis strain XJ22MSE1 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | P6F44_RS10990 | Protein ID | WP_047255277.1 |
Coordinates | 2470626..2471036 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | P6F44_RS10995 | Protein ID | WP_047255278.1 |
Coordinates | 2471017..2471283 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6F44_RS10970 | 2465891..2467561 | - | 1671 | WP_277850667.1 | single-stranded-DNA-specific exonuclease RecJ | - |
P6F44_RS10975 | 2467633..2468325 | - | 693 | WP_047255274.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P6F44_RS10980 | 2468350..2469261 | - | 912 | WP_047255275.1 | site-specific tyrosine recombinase XerD | - |
P6F44_RS10985 | 2469482..2470000 | + | 519 | WP_047255276.1 | flavodoxin FldB | - |
P6F44_RS10990 | 2470626..2471036 | - | 411 | WP_047255277.1 | protein YgfX | Toxin |
P6F44_RS10995 | 2471017..2471283 | - | 267 | WP_047255278.1 | FAD assembly factor SdhE | Antitoxin |
P6F44_RS11000 | 2471544..2472536 | + | 993 | WP_241500861.1 | tRNA-modifying protein YgfZ | - |
P6F44_RS11005 | 2472554..2473174 | + | 621 | WP_241500862.1 | HD domain-containing protein | - |
P6F44_RS11010 | 2473346..2476225 | - | 2880 | WP_047255281.1 | aminomethyl-transferring glycine dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15525.49 Da Isoelectric Point: 10.3270
>T275491 WP_047255277.1 NZ_CP120970:c2471036-2470626 [Moellerella wisconsensis]
VVLWKSNLSISWMAQLFSTCVHCVLGLVLLLAPWPTGNSIIWLPLLMVTIASWAKSQKNINKYKGIIVLTNGNKVQWKKN
EWSIITPPWCTRFGILLTLSALQGKPRKIKLWIAADAISEDDWRNLNQLLLQYPDI
VVLWKSNLSISWMAQLFSTCVHCVLGLVLLLAPWPTGNSIIWLPLLMVTIASWAKSQKNINKYKGIIVLTNGNKVQWKKN
EWSIITPPWCTRFGILLTLSALQGKPRKIKLWIAADAISEDDWRNLNQLLLQYPDI
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|