Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3941377..3942011 | Replicon | chromosome |
Accession | NZ_CP120969 | ||
Organism | Pseudomonas putida strain AHSWHJXPP1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | P3X84_RS18560 | Protein ID | WP_020308731.1 |
Coordinates | 3941377..3941781 (-) | Length | 135 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | L1LS63 |
Locus tag | P3X84_RS18565 | Protein ID | WP_003285520.1 |
Coordinates | 3941781..3942011 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3X84_RS18540 (P3X84_18540) | 3936515..3937606 | - | 1092 | WP_144188584.1 | hypothetical protein | - |
P3X84_RS18545 (P3X84_18545) | 3938368..3939783 | + | 1416 | WP_074859153.1 | YfjI family protein | - |
P3X84_RS18550 (P3X84_18550) | 3939895..3940224 | + | 330 | WP_023101967.1 | hypothetical protein | - |
P3X84_RS18555 (P3X84_18555) | 3940322..3941290 | + | 969 | WP_256825339.1 | DUF932 domain-containing protein | - |
P3X84_RS18560 (P3X84_18560) | 3941377..3941781 | - | 405 | WP_020308731.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
P3X84_RS18565 (P3X84_18565) | 3941781..3942011 | - | 231 | WP_003285520.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
P3X84_RS18570 (P3X84_18570) | 3942168..3943172 | + | 1005 | WP_256825338.1 | YqaJ viral recombinase family protein | - |
P3X84_RS18575 (P3X84_18575) | 3943264..3944214 | + | 951 | WP_144189643.1 | hydrolase or metal-binding protein | - |
P3X84_RS18580 (P3X84_18580) | 3944186..3944683 | + | 498 | WP_144188592.1 | DNA repair protein RadC | - |
P3X84_RS18585 (P3X84_18585) | 3944694..3944867 | + | 174 | WP_165362587.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3920864..3943172 | 22308 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14995.23 Da Isoelectric Point: 7.2774
>T275489 WP_020308731.1 NZ_CP120969:c3941781-3941377 [Pseudomonas putida]
MLKYMLDTNMCIFTIKNRPEQVREAFKRHSGQLSISTVTLMELIYGAEKSANPERNLADVEGFAARLEVLPYDAQAAAHS
GQLRAELARIGKPIGPYDQMIAGHARAQGLILVTNNLREFERVPGLRVEDWVNA
MLKYMLDTNMCIFTIKNRPEQVREAFKRHSGQLSISTVTLMELIYGAEKSANPERNLADVEGFAARLEVLPYDAQAAAHS
GQLRAELARIGKPIGPYDQMIAGHARAQGLILVTNNLREFERVPGLRVEDWVNA
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|