Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tad-ata/COG5606-COG4679
Location 930967..931660 Replicon chromosome
Accession NZ_CP120969
Organism Pseudomonas putida strain AHSWHJXPP1

Toxin (Protein)


Gene name tad Uniprot ID N2IHR9
Locus tag P3X84_RS04400 Protein ID WP_003151133.1
Coordinates 930967..931344 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name ata Uniprot ID N2IIN5
Locus tag P3X84_RS04405 Protein ID WP_001172026.1
Coordinates 931325..931660 (+) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P3X84_RS04375 (P3X84_04375) 926018..926389 + 372 WP_172691856.1 hypothetical protein -
P3X84_RS04380 (P3X84_04380) 926506..927390 - 885 WP_000155092.1 Mph(E) family macrolide 2'-phosphotransferase -
P3X84_RS04385 (P3X84_04385) 927446..928921 - 1476 WP_000052512.1 ABC-F type ribosomal protection protein Msr(E) -
P3X84_RS04390 (P3X84_04390) 929002..929457 - 456 WP_009873365.1 IS200/IS605 family transposase -
P3X84_RS04395 (P3X84_04395) 929534..930970 + 1437 WP_254176715.1 transposase -
P3X84_RS04400 (P3X84_04400) 930967..931344 + 378 WP_003151133.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P3X84_RS04405 (P3X84_04405) 931325..931660 + 336 WP_001172026.1 helix-turn-helix transcriptional regulator Antitoxin
P3X84_RS04410 (P3X84_04410) 931675..932010 + 336 WP_000741275.1 hypothetical protein -
P3X84_RS04415 (P3X84_04415) 932034..932360 + 327 WP_000091614.1 hypothetical protein -
P3X84_RS04420 (P3X84_04420) 932357..932728 + 372 WP_172691856.1 hypothetical protein -
P3X84_RS04425 (P3X84_04425) 932916..933755 - 840 WP_000259031.1 sulfonamide-resistant dihydropteroate synthase Sul1 -
P3X84_RS04430 (P3X84_04430) 933749..934096 - 348 WP_000679427.1 quaternary ammonium compound efflux SMR transporter QacE delta 1 -
P3X84_RS04435 (P3X84_04435) 934318..935361 + 1044 WP_076611544.1 IS110-like element ISPa62 family transposase -
P3X84_RS04440 (P3X84_04440) 935642..936433 - 792 WP_001206316.1 ANT(3'')-Ia family aminoglycoside nucleotidyltransferase AadA1 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island aph(3'')-Ib / blaNDM-14 / sul1 / qacE / blaOXA-427 / qnrVC6 / mph(E) / msr(E) / ant(3'')-Ia / catB3 / ere(A) - 877529..954476 76947
- inside IScluster/Tn blaOXA-427 / qnrVC6 / mph(E) / msr(E) / sul1 / qacE / ant(3'')-Ia / catB3 / ere(A) - 902200..945555 43355


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(16-109)

Antitoxin

Cro/C1-type helix-turn-helix domain

(40-93)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13705.78 Da        Isoelectric Point: 9.4693

>T275487 WP_003151133.1 NZ_CP120969:930967-931344 [Pseudomonas putida]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH

Download         Length: 378 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12201.39 Da        Isoelectric Point: 10.6058

>AT275487 WP_001172026.1 NZ_CP120969:931325-931660 [Pseudomonas putida]
MQKRIIEGVEVQRSSGNVFADLGLPDAEKLKIKTGLVVEIRRAMRALGLTQQAAAKRMGIPQPKVSGMMRGDFTNLSERK
LMDCLNRLGYDIEIKVRPAAEPIGHLTLATA

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A024ELN5

Antitoxin

Source ID Structure
AlphaFold DB A0A024EKI7

References