Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
Location | 920028..920721 | Replicon | chromosome |
Accession | NZ_CP120969 | ||
Organism | Pseudomonas putida strain AHSWHJXPP1 |
Toxin (Protein)
Gene name | tad | Uniprot ID | N2IHR9 |
Locus tag | P3X84_RS04330 | Protein ID | WP_003151133.1 |
Coordinates | 920028..920405 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | N2IIN5 |
Locus tag | P3X84_RS04335 | Protein ID | WP_001172026.1 |
Coordinates | 920386..920721 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3X84_RS04320 (P3X84_04320) | 916221..919250 | - | 3030 | WP_010799689.1 | Tn3 family transposase | - |
P3X84_RS04325 (P3X84_04325) | 919234..919836 | - | 603 | WP_010465829.1 | recombinase family protein | - |
P3X84_RS04330 (P3X84_04330) | 920028..920405 | + | 378 | WP_003151133.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P3X84_RS04335 (P3X84_04335) | 920386..920721 | + | 336 | WP_001172026.1 | helix-turn-helix transcriptional regulator | Antitoxin |
P3X84_RS04340 (P3X84_04340) | 920736..921071 | + | 336 | WP_000741275.1 | hypothetical protein | - |
P3X84_RS04345 (P3X84_04345) | 921095..921316 | + | 222 | Protein_834 | hypothetical protein | - |
P3X84_RS04350 (P3X84_04350) | 922004..923521 | - | 1518 | WP_277836186.1 | IS66 family transposase | - |
P3X84_RS04355 (P3X84_04355) | 923540..923899 | - | 360 | WP_024086151.1 | IS66 family insertion sequence element accessory protein TnpB | - |
P3X84_RS04360 (P3X84_04360) | 924057..925445 | - | 1389 | Protein_837 | IS66 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | aph(3'')-Ib / blaNDM-14 / sul1 / qacE / blaOXA-427 / qnrVC6 / mph(E) / msr(E) / ant(3'')-Ia / catB3 / ere(A) | - | 877529..954476 | 76947 | |
- | inside | IScluster/Tn | blaOXA-427 / qnrVC6 / mph(E) / msr(E) / sul1 / qacE / ant(3'')-Ia / catB3 / ere(A) | - | 902200..945555 | 43355 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13705.78 Da Isoelectric Point: 9.4693
>T275486 WP_003151133.1 NZ_CP120969:920028-920405 [Pseudomonas putida]
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
MTNKEKPLEWIASSHKDLMALPSDVRRRFGYALSLAQIGDQDDAAKVLKGFGGAGVLEVVEDDAGGTYRAVYTVKFAEAV
FVLHCFQKKSKSGIATPKADMDIIRARLKVAEVLAQELRNAKTNH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024ELN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A024EKI7 |