Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-higA/HigB-HigA |
Location | 340026..341017 | Replicon | chromosome |
Accession | NZ_CP120969 | ||
Organism | Pseudomonas putida strain AHSWHJXPP1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | P3X84_RS01505 | Protein ID | WP_232435437.1 |
Coordinates | 340026..340502 (+) | Length | 159 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | Q88R60 |
Locus tag | P3X84_RS01510 | Protein ID | WP_004575922.1 |
Coordinates | 340544..341017 (+) | Length | 158 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3X84_RS01485 (P3X84_01485) | 335067..336434 | - | 1368 | WP_060539158.1 | ATP-binding protein | - |
P3X84_RS01490 (P3X84_01490) | 336436..337155 | - | 720 | WP_004575925.1 | response regulator | - |
P3X84_RS01495 (P3X84_01495) | 337296..339593 | + | 2298 | WP_003255779.1 | TonB-dependent siderophore receptor | - |
P3X84_RS01500 (P3X84_01500) | 339761..339967 | - | 207 | WP_003255778.1 | DUF3079 domain-containing protein | - |
P3X84_RS01505 (P3X84_01505) | 340026..340502 | + | 477 | WP_232435437.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
P3X84_RS01510 (P3X84_01510) | 340544..341017 | + | 474 | WP_004575922.1 | transcriptional regulator | Antitoxin |
P3X84_RS01515 (P3X84_01515) | 341022..341235 | - | 214 | Protein_292 | integrase | - |
P3X84_RS01520 (P3X84_01520) | 341438..341680 | + | 243 | WP_232435436.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
P3X84_RS01525 (P3X84_01525) | 341639..341797 | - | 159 | Protein_294 | transcriptional regulator | - |
P3X84_RS01530 (P3X84_01530) | 341792..342007 | - | 216 | Protein_295 | integrase | - |
P3X84_RS01535 (P3X84_01535) | 341995..342354 | + | 360 | Protein_296 | phage portal protein | - |
P3X84_RS01540 (P3X84_01540) | 342368..342721 | - | 354 | WP_146051591.1 | hypothetical protein | - |
P3X84_RS01545 (P3X84_01545) | 342970..343512 | - | 543 | WP_004575918.1 | ImmA/IrrE family metallo-endopeptidase | - |
P3X84_RS01550 (P3X84_01550) | 344090..345013 | - | 924 | WP_259537442.1 | IS3 family transposase | - |
P3X84_RS01555 (P3X84_01555) | 345010..345303 | - | 294 | WP_060537279.1 | transposase | - |
P3X84_RS01560 (P3X84_01560) | 345566..346000 | - | 435 | WP_004577124.1 | DUF4145 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 159 a.a. Molecular weight: 18459.43 Da Isoelectric Point: 10.2237
>T275485 WP_232435437.1 NZ_CP120969:340026-340502 [Pseudomonas putida]
MTGINPLAIARSPYIAHPDIWLTDIWIRDIFHPMLVRRDNTMRVITKAAVTKAIEAHGQWKAPLSLWLTTFDRATLRFES
FEQLRQTWVTVSGWSVDRIPHSELRPASRKGPLDIYVFDIKKNECRLIAWLNARTGTLYIKAILSHAEYDKWCRSDIR
MTGINPLAIARSPYIAHPDIWLTDIWIRDIFHPMLVRRDNTMRVITKAAVTKAIEAHGQWKAPLSLWLTTFDRATLRFES
FEQLRQTWVTVSGWSVDRIPHSELRPASRKGPLDIYVFDIKKNECRLIAWLNARTGTLYIKAILSHAEYDKWCRSDIR
Download Length: 477 bp
Antitoxin
Download Length: 158 a.a. Molecular weight: 17229.67 Da Isoelectric Point: 4.4982
>AT275485 WP_004575922.1 NZ_CP120969:340544-341017 [Pseudomonas putida]
MKRDKIEANGLDAFIANISPMLDGLNTQMATMAQLLAACHDPIKDDAELEARMALIDELYSHADSEGHAAARFAEMVADR
VYEYESESVLVPFASQAEALAFLLSDRGVKQKDLSAIATQSAVSEILNNKRKMTVAQIKGFAEFFSVPVEFFMHGVV
MKRDKIEANGLDAFIANISPMLDGLNTQMATMAQLLAACHDPIKDDAELEARMALIDELYSHADSEGHAAARFAEMVADR
VYEYESESVLVPFASQAEALAFLLSDRGVKQKDLSAIATQSAVSEILNNKRKMTVAQIKGFAEFFSVPVEFFMHGVV
Download Length: 474 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|