Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /SpoIISA(toxin) |
| Location | 2334711..2335689 | Replicon | chromosome |
| Accession | NZ_CP120958 | ||
| Organism | Bacillus cereus strain SCBCM001 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | W8Y388 |
| Locus tag | P4G50_RS12010 | Protein ID | WP_000624977.1 |
| Coordinates | 2334711..2335448 (+) | Length | 246 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | M1PKC2 |
| Locus tag | P4G50_RS12015 | Protein ID | WP_000237819.1 |
| Coordinates | 2335561..2335689 (+) | Length | 43 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P4G50_RS11990 | 2330354..2331136 | + | 783 | WP_065212733.1 | class I SAM-dependent methyltransferase | - |
| P4G50_RS11995 | 2331294..2332979 | - | 1686 | WP_195862588.1 | alpha-keto acid decarboxylase family protein | - |
| P4G50_RS12000 | 2333087..2333569 | + | 483 | WP_000191888.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| P4G50_RS12005 | 2333735..2334472 | + | 738 | WP_000594152.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
| P4G50_RS12010 | 2334711..2335448 | + | 738 | WP_000624977.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| P4G50_RS12015 | 2335561..2335689 | + | 129 | WP_000237819.1 | hypothetical protein | Antitoxin |
| P4G50_RS12020 | 2335762..2335938 | + | 177 | WP_000852629.1 | stage II sporulation protein SB | - |
| P4G50_RS12025 | 2335958..2336347 | - | 390 | WP_000713863.1 | YxeA family protein | - |
| P4G50_RS12030 | 2336559..2338028 | + | 1470 | WP_000287556.1 | beta-Ala-His dipeptidase | - |
| P4G50_RS12035 | 2338274..2339083 | + | 810 | WP_000678370.1 | papain-like cysteine protease family protein | - |
| P4G50_RS12040 | 2339109..2339711 | + | 603 | WP_139846814.1 | hypothetical protein | - |
| P4G50_RS12045 | 2339955..2340206 | - | 252 | WP_000827560.1 | LuxR C-terminal-related transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28307.03 Da Isoelectric Point: 8.2998
>T275484 WP_000624977.1 NZ_CP120958:2334711-2335448 [Bacillus cereus]
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|