Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 242929..243571 | Replicon | chromosome |
Accession | NZ_CP120958 | ||
Organism | Bacillus cereus strain SCBCM001 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | J8CWW5 |
Locus tag | P4G50_RS01385 | Protein ID | WP_000635963.1 |
Coordinates | 243221..243571 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | P4G50_RS01380 | Protein ID | WP_000004570.1 |
Coordinates | 242929..243216 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P4G50_RS01355 | 238246..239208 | + | 963 | WP_000961165.1 | UV DNA damage repair endonuclease UvsE | - |
P4G50_RS01360 | 239201..239773 | - | 573 | WP_000908523.1 | rhomboid family intramembrane serine protease | - |
P4G50_RS01365 | 239867..240226 | + | 360 | WP_000583416.1 | holo-ACP synthase | - |
P4G50_RS01370 | 240383..241333 | + | 951 | WP_002004297.1 | outer membrane lipoprotein carrier protein LolA | - |
P4G50_RS01375 | 241451..242620 | + | 1170 | WP_000390615.1 | alanine racemase | - |
P4G50_RS01380 | 242929..243216 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
P4G50_RS01385 | 243221..243571 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
P4G50_RS01390 | 243639..245807 | + | 2169 | WP_000426242.1 | Tex family protein | - |
P4G50_RS01395 | 245865..245981 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
P4G50_RS01400 | 246177..246635 | + | 459 | WP_000344234.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T275483 WP_000635963.1 NZ_CP120958:243221-243571 [Bacillus cereus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4HKE | |
PDB | 7BXY |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366FY90 |