Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/- |
Location | 5850138..5850718 | Replicon | chromosome |
Accession | NZ_CP120956 | ||
Organism | Delftia tsuruhatensis strain Ery-6A |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A072T5F9 |
Locus tag | PYR84_RS26505 | Protein ID | WP_016448367.1 |
Coordinates | 5850338..5850718 (+) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A072THC0 |
Locus tag | PYR84_RS26500 | Protein ID | WP_016448366.1 |
Coordinates | 5850138..5850341 (+) | Length | 68 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PYR84_RS26490 (PYR84_26490) | 5847381..5849066 | - | 1686 | WP_277849001.1 | VRR-NUC domain-containing protein | - |
PYR84_RS26495 (PYR84_26495) | 5849175..5849987 | - | 813 | WP_277849002.1 | glucose 1-dehydrogenase | - |
PYR84_RS26500 (PYR84_26500) | 5850138..5850341 | + | 204 | WP_016448366.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
PYR84_RS26505 (PYR84_26505) | 5850338..5850718 | + | 381 | WP_016448367.1 | PIN domain-containing protein | Toxin |
PYR84_RS26510 (PYR84_26510) | 5850796..5851548 | - | 753 | WP_277849003.1 | helix-turn-helix transcriptional regulator | - |
PYR84_RS26515 (PYR84_26515) | 5851778..5853364 | + | 1587 | WP_277849004.1 | Ig-like domain repeat protein | - |
PYR84_RS26520 (PYR84_26520) | 5853411..5854169 | - | 759 | WP_016452684.1 | ABC transporter permease | - |
PYR84_RS26525 (PYR84_26525) | 5854166..5855407 | - | 1242 | WP_016448371.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13790.24 Da Isoelectric Point: 8.3155
>T275481 WP_016448367.1 NZ_CP120956:5850338-5850718 [Delftia tsuruhatensis]
MNPVLVDTSVWIDHFRQGNPHLAQLLQQDMALMHPLVLGELACGTPPARARTLADLQRLKPARQASMREVLALIEREQLF
GLGCGLVDITLLASALMSSGASLWSLDKRLHALAQRFGIACRSVLP
MNPVLVDTSVWIDHFRQGNPHLAQLLQQDMALMHPLVLGELACGTPPARARTLADLQRLKPARQASMREVLALIEREQLF
GLGCGLVDITLLASALMSSGASLWSLDKRLHALAQRFGIACRSVLP
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A072T5F9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A072THC0 |