Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) chpSB/PRK09812-MazE
Location 56796..57391 Replicon plasmid pBCO-1
Accession NZ_CP120950
Organism Burkholderia contaminans strain 5080

Toxin (Protein)


Gene name chpB Uniprot ID A0A6P2RVL2
Locus tag P4E65_RS39100 Protein ID WP_039341512.1
Coordinates 57041..57391 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name chpS Uniprot ID -
Locus tag P4E65_RS39095 Protein ID WP_076841588.1
Coordinates 56796..57047 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P4E65_RS39075 (P4E65_39075) 52536..53819 + 1284 WP_069586065.1 TrbI/VirB10 family protein -
P4E65_RS39080 (P4E65_39080) 53816..54931 + 1116 WP_069586064.1 P-type DNA transfer ATPase VirB11 -
P4E65_RS39085 (P4E65_39085) 54935..55075 + 141 WP_157644980.1 hypothetical protein -
P4E65_RS39090 (P4E65_39090) 55108..56589 + 1482 WP_069586063.1 hypothetical protein -
P4E65_RS39095 (P4E65_39095) 56796..57047 + 252 WP_076841588.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
P4E65_RS39100 (P4E65_39100) 57041..57391 + 351 WP_039341512.1 type II toxin-antitoxin system ChpB family toxin Toxin
P4E65_RS39105 (P4E65_39105) 57404..57646 + 243 WP_039341511.1 hypothetical protein -
P4E65_RS39110 (P4E65_39110) 57695..58048 + 354 WP_157644981.1 hypothetical protein -
P4E65_RS39115 (P4E65_39115) 58020..58229 + 210 WP_039341506.1 hypothetical protein -
P4E65_RS39120 (P4E65_39120) 58301..58975 + 675 WP_076841591.1 hypothetical protein -
P4E65_RS39125 (P4E65_39125) 59020..59244 + 225 WP_039341503.1 hypothetical protein -
P4E65_RS39130 (P4E65_39130) 59327..59677 + 351 WP_046196913.1 hypothetical protein -
P4E65_RS39135 (P4E65_39135) 59686..59916 + 231 WP_083268473.1 hypothetical protein -
P4E65_RS39140 (P4E65_39140) 60066..60479 + 414 WP_069586059.1 hypothetical protein -
P4E65_RS39145 (P4E65_39145) 60531..60653 + 123 WP_256103105.1 hypothetical protein -
P4E65_RS39150 (P4E65_39150) 60757..61221 + 465 WP_039341501.1 hypothetical protein -
P4E65_RS39155 (P4E65_39155) 61237..61782 + 546 WP_175035022.1 phospholipase D family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..95791 95791


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(7-116)

Antitoxin

Antitoxin PemI-like

(1-83)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12400.34 Da        Isoelectric Point: 8.6851

>T275475 WP_039341512.1 NZ_CP120950:57041-57391 [Burkholderia contaminans]
MVRRVKFERGDIVRVSLNPTIGKEQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARYAGFAVPLSGAGTETQGVALV
NMVRTLDLEARGARKVERAPVEVVEDALARLQTILE

Download         Length: 351 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 8904.14 Da        Isoelectric Point: 4.9679

>AT275475 WP_076841588.1 NZ_CP120950:56796-57047 [Burkholderia contaminans]
MELKIQKWGNSAAVRLPAVLLEQIGASAGSSLNADVRPDGVLLTPARRKYSLDELVAQCDQNAPQPADLAAWVEAKPVGH
EAW

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6P2RVL2

Antitoxin

Source ID Structure

References