Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 1018274..1018869 | Replicon | chromosome |
| Accession | NZ_CP120949 | ||
| Organism | Burkholderia contaminans strain 5080 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | A0A1E3FP25 |
| Locus tag | P4E65_RS36445 | Protein ID | WP_039362634.1 |
| Coordinates | 1018274..1018624 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | A0A0G3Z282 |
| Locus tag | P4E65_RS36450 | Protein ID | WP_039362633.1 |
| Coordinates | 1018618..1018869 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P4E65_RS36435 (P4E65_36435) | 1015129..1016589 | + | 1461 | WP_039362635.1 | efflux RND transporter periplasmic adaptor subunit | - |
| P4E65_RS36440 (P4E65_36440) | 1016621..1018150 | + | 1530 | WP_039362750.1 | efflux transporter outer membrane subunit | - |
| P4E65_RS36445 (P4E65_36445) | 1018274..1018624 | - | 351 | WP_039362634.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
| P4E65_RS36450 (P4E65_36450) | 1018618..1018869 | - | 252 | WP_039362633.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| P4E65_RS36455 (P4E65_36455) | 1019402..1021222 | + | 1821 | WP_046197074.1 | asparagine synthase (glutamine-hydrolyzing) | - |
| P4E65_RS36460 (P4E65_36460) | 1021454..1022914 | - | 1461 | WP_039362631.1 | heavy metal sensor histidine kinase | - |
| P4E65_RS36465 (P4E65_36465) | 1022911..1023588 | - | 678 | WP_039362629.1 | heavy metal response regulator transcription factor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12403.30 Da Isoelectric Point: 10.0752
>T275474 WP_039362634.1 NZ_CP120949:c1018624-1018274 [Burkholderia contaminans]
MVRRVKFERGDIVRVSLNPTVGKEQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARYAGFAVPLSGSGTETQGVALV
NMVRTLDLQARGARKVERAPSEVIEDALARLQTILE
MVRRVKFERGDIVRVSLNPTVGKEQQGDFRPALVLSPAAFNALGVALVAPITQGGEFARYAGFAVPLSGSGTETQGVALV
NMVRTLDLQARGARKVERAPSEVIEDALARLQTILE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1E3FP25 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0G3Z282 |