Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2366457..2367098 | Replicon | chromosome |
| Accession | NZ_CP120948 | ||
| Organism | Burkholderia contaminans strain 5080 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A1E3FZX6 |
| Locus tag | P4E65_RS28005 | Protein ID | WP_039344753.1 |
| Coordinates | 2366457..2366795 (+) | Length | 113 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A1J9PWC2 |
| Locus tag | P4E65_RS28010 | Protein ID | WP_039344756.1 |
| Coordinates | 2366799..2367098 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P4E65_RS27995 (P4E65_27995) | 2363022..2364455 | - | 1434 | WP_039344747.1 | aldehyde dehydrogenase family protein | - |
| P4E65_RS28000 (P4E65_28000) | 2364485..2366125 | - | 1641 | WP_039344750.1 | acetolactate synthase large subunit | - |
| P4E65_RS28005 (P4E65_28005) | 2366457..2366795 | + | 339 | WP_039344753.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P4E65_RS28010 (P4E65_28010) | 2366799..2367098 | + | 300 | WP_039344756.1 | putative addiction module antidote protein | Antitoxin |
| P4E65_RS28015 (P4E65_28015) | 2367147..2368433 | - | 1287 | WP_039344759.1 | DUF445 domain-containing protein | - |
| P4E65_RS28020 (P4E65_28020) | 2368604..2369824 | - | 1221 | WP_039344761.1 | anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase | - |
| P4E65_RS28025 (P4E65_28025) | 2369814..2370140 | - | 327 | WP_039344765.1 | anthranilate 1,2-dioxygenase ferredoxin subunit AndAb | - |
| P4E65_RS28030 (P4E65_28030) | 2370161..2370649 | - | 489 | WP_011355917.1 | anthranilate 1,2-dioxygenase small subunit AndAd | - |
| P4E65_RS28035 (P4E65_28035) | 2370664..2371935 | - | 1272 | WP_039344770.1 | anthranilate 1,2-dioxygenase large subunit AndAc | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12583.47 Da Isoelectric Point: 9.5691
>T275473 WP_039344753.1 NZ_CP120948:2366457-2366795 [Burkholderia contaminans]
MVDILQSMPYSAPTFSIRTTGVFDTWFAGLQDRVAKRRIQARIDRLSMGNPGDWKSAGSPVVEMRIDHGPGYRVYYVRRG
TIWVILLCGGDKSSQQADIRAAHAMLAHLDME
MVDILQSMPYSAPTFSIRTTGVFDTWFAGLQDRVAKRRIQARIDRLSMGNPGDWKSAGSPVVEMRIDHGPGYRVYYVRRG
TIWVILLCGGDKSSQQADIRAAHAMLAHLDME
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1E3FZX6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J9PWC2 |