Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 1498726..1499365 | Replicon | chromosome |
| Accession | NZ_CP120948 | ||
| Organism | Burkholderia contaminans strain 5080 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | P4E65_RS24200 | Protein ID | WP_223274309.1 |
| Coordinates | 1498949..1499365 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A1X1PQC0 |
| Locus tag | P4E65_RS24195 | Protein ID | WP_039351245.1 |
| Coordinates | 1498726..1498962 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P4E65_RS24180 (P4E65_24180) | 1494508..1496088 | + | 1581 | WP_039350882.1 | FadD3 family acyl-CoA ligase | - |
| P4E65_RS24185 (P4E65_24185) | 1496127..1496900 | + | 774 | WP_039351252.1 | SDR family oxidoreductase | - |
| P4E65_RS24190 (P4E65_24190) | 1497693..1498352 | + | 660 | WP_046196544.1 | hypothetical protein | - |
| P4E65_RS24195 (P4E65_24195) | 1498726..1498962 | + | 237 | WP_039351245.1 | DNA-binding protein | Antitoxin |
| P4E65_RS24200 (P4E65_24200) | 1498949..1499365 | + | 417 | WP_223274309.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P4E65_RS24205 (P4E65_24205) | 1499565..1500461 | + | 897 | WP_039350875.1 | VOC family protein | - |
| P4E65_RS24210 (P4E65_24210) | 1500471..1501364 | + | 894 | WP_039350872.1 | CoA-transferase | - |
| P4E65_RS24215 (P4E65_24215) | 1501375..1502172 | + | 798 | WP_039350869.1 | ketoacid CoA transferase | - |
| P4E65_RS24220 (P4E65_24220) | 1502181..1503113 | + | 933 | WP_039350867.1 | enoyl-CoA hydratase | - |
| P4E65_RS24225 (P4E65_24225) | 1503110..1504198 | + | 1089 | WP_039350864.1 | nitronate monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15370.68 Da Isoelectric Point: 7.4021
>T275471 WP_223274309.1 NZ_CP120948:1498949-1499365 [Burkholderia contaminans]
VYLIDTNIISEIRKGKRTNRGVRAFFRQAAADASPLYLSVVTVAELRRGVDLIRHRGDHPQASALEAWMATILSGYAPNI
LPVDIEISQMWGHLRVPDPTHELDKLIAATALINDLTVVTRNVEDFARTGVKLLNPFD
VYLIDTNIISEIRKGKRTNRGVRAFFRQAAADASPLYLSVVTVAELRRGVDLIRHRGDHPQASALEAWMATILSGYAPNI
LPVDIEISQMWGHLRVPDPTHELDKLIAATALINDLTVVTRNVEDFARTGVKLLNPFD
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|